Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. An IgM anti-MBP Ab in a case of Waldenstrom's macroglobulinemia with polyneuropathy expressing an idiotype reactive with an MBP epitope immunodominant...

    ID: 1688577

    Description: epitope description:VHFFKNIVTPRTP antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens

    Publication: 11137588;

  2. An IgM anti-MBP Ab in a case of Waldenstrom's macroglobulinemia with polyneuropathy expressing an idiotype reactive with an MBP epitope immunodominant...

    ID: 1688584

    Description: epitope description:TPRTPPPSQGKGRGLSLSRFSWGA antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens

    Publication: 11137588;

  3. An IgM anti-MBP Ab in a case of Waldenstrom's macroglobulinemia with polyneuropathy expressing an idiotype reactive with an MBP epitope immunodominant...

    ID: 1688589

    Description: epitope description:RFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVH antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens

    Publication: 11137588;

  4. An IgM anti-MBP Ab in a case of Waldenstrom's macroglobulinemia with polyneuropathy expressing an idiotype reactive with an MBP epitope immunodominant...

    ID: 1688596

    Description: epitope description:TPRTPPPSQGKGRGLSLSRFSWGA antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens

    Publication: 11137588;

  5. Immunochemical analysis of Lewis rat antisera to the synthetic encephalitogenic peptide S49.

    ID: 1688699

    Description: epitope description:GSLPQKAQRPQDENG host organism:Rattus norvegicus Lewis antibody name:HLR-1, HLR-2, HLR-3, HLR-4, HLR-5.

    Publication: 2418380;

  6. Immunochemical analysis of Lewis rat antisera to the synthetic encephalitogenic peptide S49.

    ID: 1688701

    Description: epitope description:GSLPQKAQRPQDENG host organism:Rattus norvegicus Lewis antibody name:HLR-6.

    Publication: 2418380;

  7. Immunochemical analysis of Lewis rat antisera to the synthetic encephalitogenic peptide S49.

    ID: 1688702

    Description: epitope description:GSLPQKAQRPQDENG host organism:Rattus norvegicus Lewis antibody name:HLR-2

    Publication: 2418380;

  8. Immunochemical analysis of Lewis rat antisera to the synthetic encephalitogenic peptide S49.

    ID: 1688737

    Description: epitope description:GSLPQKAQRPQDENG host organism:Rattus norvegicus Lewis antibody name:HLR-6

    Publication: 2418380;

  9. Immunochemical analysis of Lewis rat antisera to the synthetic encephalitogenic peptide S49.

    ID: 1688738

    Description: epitope description:YGSLPQKAQRPQDENG host organism:Rattus norvegicus Lewis antibody name:HLR-6

    Publication: 2418380;

  10. The epitope study of alpha-fodrin autoantibody in primary Sjögren's syndrome.

    ID: 1689198

    Description: epitope description:MDPSGVKVLETAE antigen name:Spectrin alpha chain, non-erythrocytic 1 host organism:Homo sapiens

    Publication: 17614976;

  11. Immunochemical analysis of Lewis rat antisera to the synthetic encephalitogenic peptide S49.

    ID: 1689201

    Description: epitope description:GSLPQKAQGHRPQDEN antigen name:Myelin basic protein host organism:Rattus norvegicus Lewis antibody name:HLR-1, HLR-2, HLR-3, HLR-4,...

    Publication: 2418380;

  12. The epitope study of alpha-fodrin autoantibody in primary Sjögren's syndrome.

    ID: 1689204

    Description: epitope description:QKLEDSYRFQFFQ antigen name:Spectrin alpha chain, non-erythrocytic 1 host organism:Homo sapiens

    Publication: 17614976;

  13. The epitope study of alpha-fodrin autoantibody in primary Sjögren's syndrome.

    ID: 1689206

    Description: epitope description:FQFFQRDAEELEKW antigen name:Spectrin alpha chain, non-erythrocytic 1 host organism:Homo sapiens

    Publication: 17614976;

  14. Structural, molecular and immunological properties of linear B-cell epitopes of Ro60KD autoantigen.

    ID: 1689217

    Description: epitope description:TKYKQRNGWSHKDLLRLSHLKP antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 9519868;

  15. Anti-NMDA receptor autoantibodies in patients with systemic lupus erythematosus and their first-degree relatives.

    ID: 1689220

    Description: epitope description:DWEYSVWLSN antigen name:Glutamate receptor ionotropic, NMDA 2A host organism:Homo sapiens

    Publication: 17576734;

  16. Structural, molecular and immunological properties of linear B-cell epitopes of Ro60KD autoantigen.

    ID: 1689223

    Description: epitope description:TKYKQRNGWSHKDLLRLSHLKP antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 9519868;

  17. Structural, molecular and immunological properties of linear B-cell epitopes of Ro60KD autoantigen.

    ID: 1689225

    Description: epitope description:TKYKQRNGWSHKDLLRLSHLKP antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 9519868;

  18. Structural, molecular and immunological properties of linear B-cell epitopes of Ro60KD autoantigen.

    ID: 1689229

    Description: epitope description:RPDAEYWNSQKDLLEQKRGR antigen name:HLA class II histocompatibility antigen, DRB1-3 chain host organism:Homo sapiens

    Publication: 9519868;

  19. Structural, molecular and immunological properties of linear B-cell epitopes of Ro60KD autoantigen.

    ID: 1689231

    Description: epitope description:RPDAEYWNSQKDLLEQKRGR antigen name:HLA class II histocompatibility antigen, DRB1-3 chain host organism:Homo sapiens

    Publication: 9519868;

  20. A major autoepitope is present on the amino terminus of a human SS-A/Ro polypeptide.

    ID: 1689233

    Description: epitope description:KEQFLDGDGWTSRWIESK antigen name:Calreticulin host organism:Homo sapiens

    Publication: 2477002;

  21. Human T-cell lymphotropic virus (HTLV)-related endogenous sequence, HRES-1, encodes a 28-kDa protein: a possible autoantigen for HTLV-I gag-reactive a...

    ID: 1689254

    Description: epitope description:PTRAPSGPRPP antigen name:Putative HTLV-1-related endogenous sequence host organism:Oryctolagus cuniculus antibody name:Ab 232

    Publication: 1347429;

  22. Human T-cell lymphotropic virus (HTLV)-related endogenous sequence, HRES-1, encodes a 28-kDa protein: a possible autoantigen for HTLV-I gag-reactive a...

    ID: 1689255

    Description: epitope description:PTRAPSGPRPP antigen name:Putative HTLV-1-related endogenous sequence host organism:Oryctolagus cuniculus antibody name:Ab 232

    Publication: 1347429;

  23. Human T-cell lymphotropic virus (HTLV)-related endogenous sequence, HRES-1, encodes a 28-kDa protein: a possible autoantigen for HTLV-I gag-reactive a...

    ID: 1689261

    Description: epitope description:PTRAPSGPRPP antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

    Publication: 1347429;

  24. Human T-cell lymphotropic virus (HTLV)-related endogenous sequence, HRES-1, encodes a 28-kDa protein: a possible autoantigen for HTLV-I gag-reactive a...

    ID: 1689277

    Description: epitope description:RRREGPDRSPR antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

    Publication: 1347429;

  25. A major autoepitope is present on the amino terminus of a human SS-A/Ro polypeptide.

    ID: 1689354

    Description: epitope description:KEQFLDGDGWTSRWIESK antigen name:Calreticulin host organism:Homo sapiens

    Publication: 2477002;

  26. Anticardiolipin antibodies in autoimmune thrombocytopenic purpura.

    ID: 1689365

    Description: epitope description:cardiolipin host organism:Homo sapiens antibody name:Human sera

    Publication: 4038606;

  27. IgG antibodies from patients with primary Sjögren's syndrome and systemic lupus erythematosus recognize different epitopes in 60-kD SSA/Ro protei...

    ID: 1689373

    Description: epitope description:MEESVNQMQPLNEKQIANSQDGY antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 1378364;

  28. IgG antibodies from patients with primary Sjögren's syndrome and systemic lupus erythematosus recognize different epitopes in 60-kD SSA/Ro protei...

    ID: 1689391

    Description: epitope description:DGYVWQVTDMNRLHRFLCFGS antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 1378364;

  29. IgG antibodies from patients with primary Sjögren's syndrome and systemic lupus erythematosus recognize different epitopes in 60-kD SSA/Ro protei...

    ID: 1689396

    Description: epitope description:VCEKLCNEKLLKKARIHPFHI antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 1378364;

  30. IgG antibodies from patients with primary Sjögren's syndrome and systemic lupus erythematosus recognize different epitopes in 60-kD SSA/Ro protei...

    ID: 1689400

    Description: epitope description:KLIVCGMTSNGFTIADPDDRGMLD antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 1378364;

  31. Mapping of epitopes on the 86 kDa subunit of the Ku autoantigen.

    ID: 1689617

    Description: epitope description:EEAKKFLAPK antigen name:X-ray repair cross-complementing protein 5 host organism:Mus musculus BALB/c antibody name:RZ-2, 2D-9

    Publication: 1700287;

  32. Anticardiolipin antibodies: detection by radioimmunoassay and association with thrombosis in systemic lupus erythematosus.

    ID: 1689627

    Description: epitope description:cardiolipin host organism:Homo sapiens antibody name:Human sera

    Publication: 6139567;

  33. The value of synthetic linear epitope analogues of La/SSB for the detection of autoantibodies to La/SSB; specificity, sensitivity and comparison of me...

    ID: 1689667

    Description: epitope description:TLHKAFKGSIFVVFDSIESA antigen name:Lupus La protein host organism:Homo sapiens

    Publication: 9566804;

  34. The value of synthetic linear epitope analogues of La/SSB for the detection of autoantibodies to La/SSB; specificity, sensitivity and comparison of me...

    ID: 1689693

    Description: epitope description:GSGKGKVQFQGKKTKF antigen name:Lupus La protein host organism:Homo sapiens

    Publication: 9566804;

  35. Preferential recognition of the phosphorylated major linear B-cell epitope of La/SSB 349-368 aa by anti-La/SSB autoantibodies from patients with syste...

    ID: 1689747

    Description: epitope description:GSGKGKVQFQGKKTKF antigen name:Lupus La protein host organism:Homo sapiens

    Publication: 16734612;

  36. The value of synthetic linear epitope analogues of La/SSB for the detection of autoantibodies to La/SSB; specificity, sensitivity and comparison of me...

    ID: 1689822

    Description: epitope description:VTWEVLEGEVEKEALKKI antigen name:Lupus La protein host organism:Homo sapiens

    Publication: 9566804;

  37. Post-translational modifications of the major linear epitope 169-190aa of Ro60 kDa autoantigen alter the autoantibody binding.

    ID: 1689824

    Description: epitope description:TKYKQRNGWSHKDLLRLSHLKP antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 16968399;

  38. Post-translational modifications of the major linear epitope 169-190aa of Ro60 kDa autoantigen alter the autoantibody binding.

    ID: 1689832

    Description: epitope description:TKYKQRNGWSHKDLLRLSHLKP + CITR(R6, R16) antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 16968399;

  39. Post-translational modifications of the major linear epitope 169-190aa of Ro60 kDa autoantigen alter the autoantibody binding.

    ID: 1689834

    Description: epitope description:TKYKQRNGWSHKDLLRLSHLKP + CITR(R6, R16) antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 16968399;

  40. Induction of autoimmunity by multivalent immunodominant and subdominant T cell determinants of La (SS-B).

    ID: 1689842

    Description: epitope description:NANNGNLQLRNKEVT antigen name:Lupus La protein homolog host organism:Mus musculus A/J

    Publication: 10072561;

  41. Induction of autoimmunity by multivalent immunodominant and subdominant T cell determinants of La (SS-B).

    ID: 1689843

    Description: epitope description:NANNGNLQLRNKEVT antigen name:Lupus La protein homolog host organism:Mus musculus A/J

    Publication: 10072561;

  42. A novel epitope on the C-terminus of SmD1 is recognized by the majority of sera from patients with systemic lupus erythematosus.

    ID: 1689850

    Description: epitope description:VRFLMKLSHETVT antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

    Publication: 9710444;

  43. A novel epitope on the C-terminus of SmD1 is recognized by the majority of sera from patients with systemic lupus erythematosus.

    ID: 1689882

    Description: epitope description:RGRGRGRGRGRGR antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

    Publication: 9710444;

  44. A novel epitope on the C-terminus of SmD1 is recognized by the majority of sera from patients with systemic lupus erythematosus.

    ID: 1689902

    Description: epitope description:ETVTIELKNGTQV antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

    Publication: 9710444;

  45. A novel epitope on the C-terminus of SmD1 is recognized by the majority of sera from patients with systemic lupus erythematosus.

    ID: 1689907

    Description: epitope description:TITGVDVSMNTHL antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

    Publication: 9710444;

  46. A novel epitope on the C-terminus of SmD1 is recognized by the majority of sera from patients with systemic lupus erythematosus.

    ID: 1689917

    Description: epitope description:LSIRGNRIRYFIL antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

    Publication: 9710444;

  47. A novel epitope on the C-terminus of SmD1 is recognized by the majority of sera from patients with systemic lupus erythematosus.

    ID: 1689920

    Description: epitope description:YFILPDSLPLDTI antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

    Publication: 9710444;

  48. A novel epitope on the C-terminus of SmD1 is recognized by the majority of sera from patients with systemic lupus erythematosus.

    ID: 1689922

    Description: epitope description:SLPLDTIRVDVEP antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

    Publication: 9710444;

  49. A novel epitope on the C-terminus of SmD1 is recognized by the majority of sera from patients with systemic lupus erythematosus.

    ID: 1689926

    Description: epitope description:VEPKVKSKKREAV antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

    Publication: 9710444;

  50. A novel epitope on the C-terminus of SmD1 is recognized by the majority of sera from patients with systemic lupus erythematosus.

    ID: 1689932

    Description: epitope description:GRGRGRGRGRGRG antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

    Publication: 9710444;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston