Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Effective induction of neutralizing antibodies with the amino terminus of VP2 of canine parvovirus as a synthetic peptide.

    ID: 1511956

    Description: epitope description:RALGLPPFLNSLPQS antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7887026;

  2. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511958

    Description: epitope description:RAVFMQQRPLRM antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  3. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511959

    Description: epitope description:VFMQQRPLRMFL antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  4. Effective induction of neutralizing antibodies with the amino terminus of VP2 of canine parvovirus as a synthetic peptide.

    ID: 1511967

    Description: epitope description:QQMSINVDNQFNYVP antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7887026;

  5. IgG subclass-associated differences in anti-schistosomal antibody specificity.

    ID: 1513252

    Description: epitope description:ETDEEYYSVEKLIGQAEDVEHEYHK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens

    Publication: 7997850;

  6. IgG subclass-associated differences in anti-schistosomal antibody specificity.

    ID: 1513278

    Description: epitope description:KPQEEKEKITKEILNGK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens

    Publication: 7997850;

  7. IgG subclass-associated differences in anti-schistosomal antibody specificity.

    ID: 1513279

    Description: epitope description:KPQEEKEKITKEILNGK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens

    Publication: 7997850;

  8. Identification and characterization of T helper cell epitopes of the major outer membrane protein of Chlamydia trachomatis.

    ID: 1513315

    Description: epitope description:ALNIWDRFDVFCTLGATTGYLKGNSPTTSDVAGLEKDPVA host organism:Mus musculus A/J

    Publication: 1694217;

  9. IgG subclass-associated differences in anti-schistosomal antibody specificity.

    ID: 1513319

    Description: epitope description:LADLVLIAVIDHVTDLDK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens

    Publication: 7997850;

  10. Characterization of intertype specific epitopes on adenovirus hexons.

    ID: 1513324

    Description: epitope description:NQAVDSYDPD antigen name:Hexon protein host organism:Mus musculus BALB/c

    Publication: 9787653;

  11. Characterization of intertype specific epitopes on adenovirus hexons.

    ID: 1513329

    Description: epitope description:NQAVDSYDPD antigen name:Hexon protein host organism:Mus musculus BALB/c

    Publication: 9787653;

  12. Identification and characterization of T helper cell epitopes of the major outer membrane protein of Chlamydia trachomatis.

    ID: 1513333

    Description: epitope description:KMKSRKSCGIAVGTTWDADKYAVTPTTSDVAGLEKDPVA host organism:Mus musculus A/J

    Publication: 1694217;

  13. Identification and characterization of T helper cell epitopes of the major outer membrane protein of Chlamydia trachomatis.

    ID: 1513334

    Description: epitope description:KMKSRKSCGIAVGTTWDADKYAVTPTTSDVAGLEKDPVA host organism:Mus musculus A/J

    Publication: 1694217;

  14. Evaluation of mutagenesis for epitope mapping. Structure of an antibody-protein antigen complex.

    ID: 1513458

    Description: epitope description:M1, F2, Q3, Q4, T34, S41, S64, E66, G67, E68, E70, Q71, K72, E75 antigen name:Phosphocarrier protein HPr host organism:Mus musculu...

    Publication: 7684366;

  15. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513483

    Description: epitope description:VDELD antigen name:Basic phospholipase A2 pseudexin B chain host organism:Mus musculus BALB/c antibody name:mAb 2

    Publication: 1718309;

  16. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513486

    Description: epitope description:YGCYCGLGG antigen name:Phospholipase A2, major isoenzyme host organism:Mus musculus BALB/c antibody name:Mab 14

    Publication: 1718309;

  17. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513487

    Description: epitope description:YGCYCGAGG antigen name:Basic phospholipase A2 notechis 11'2 host organism:Mus musculus BALB/c antibody name:Mab 14

    Publication: 1718309;

  18. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513491

    Description: epitope description:FPKMSAYDY antigen name:Scutoxin host organism:Mus musculus BALB/c antibody name:Mab 14

    Publication: 1718309;

  19. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513496

    Description: epitope description:NTKWDIYRY antigen name:Phospholipase A2 crotoxin basic chain CBa2 host organism:Mus musculus BALB/c antibody name:Mab 14

    Publication: 1718309;

  20. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513499

    Description: epitope description:IDDLD antigen name:Acidic phospholipase A2 homolog taipoxin gamma chain host organism:Mus musculus BALB/c antibody name:Mab 2

    Publication: 1718309;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston