Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. An immune response directed to proteinase and adhesin functional epitopes protects against Porphyromonas gingivalis-induced periodontal bone loss.

    ID: 1966253

    Description: epitope description:ISLANYTG antigen name:Arginine-specific cysteine proteinase RgpA host organism:Mus musculus BALB/c

    Publication: 16148146;

  2. An immune response directed to proteinase and adhesin functional epitopes protects against Porphyromonas gingivalis-induced periodontal bone loss.

    ID: 1966258

    Description: epitope description:YTGHGSET antigen name:Arginine-specific cysteine proteinase RgpA host organism:Mus musculus BALB/c

    Publication: 16148146;

  3. Structure of hepatitis C virus envelope glycoprotein E2 antigenic site 412 to 423 in complex with antibody AP33.

    ID: 1966260

    Description: epitope description:QLINTNGSWHIN antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:AP33

    Publication: 22973046;

  4. Identification of a conserved linear B-cell epitope in the M protein of porcine epidemic diarrhea virus.

    ID: 1966267

    Description: epitope description:WAFYVR antigen name:Membrane protein host organism:Mus musculus BALB/c antibody name:4D4

    Publication: 23025700;

  5. Identification of a conserved linear B-cell epitope in the M protein of porcine epidemic diarrhea virus.

    ID: 1966269

    Description: epitope description:WAFYVR antigen name:Membrane protein host organism:Mus musculus BALB/c antibody name:4D4

    Publication: 23025700;

  6. A plaque-specific antibody clears existing beta-amyloid plaques in Alzheimer's disease mice.

    ID: 1966273

    Description: epitope description:DAEFR antigen name:Amyloid beta A4 protein host organism:Mus musculus

    Publication: 23217740;

  7. A plaque-specific antibody clears existing beta-amyloid plaques in Alzheimer's disease mice.

    ID: 1966283

    Description: epitope description:EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA + PYRE(E1) antigen name:Amyloid beta A4 protein host organism:Mus musculus

    Publication: 23217740;

  8. The structure of a polyQ-anti-polyQ complex reveals binding according to a linear lattice model.

    ID: 1966326

    Description: epitope description:GQQQQQQQQQQG host organism:Mus musculus BALB/c antibody name:MW1

    Publication: 17450152;

  9. Investigating the impact of hepatitis B virus surface gene polymorphism on antigenicity using ex vivo phenotyping.

    ID: 1966328

    Description: epitope description:CRTCTTPAQ antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:P2D3

    Publication: 22855781;

  10. Investigating the impact of hepatitis B virus surface gene polymorphism on antigenicity using ex vivo phenotyping.

    ID: 1966331

    Description: epitope description:CRTCTTPAQ antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:P2D3

    Publication: 22855781;

  11. Mechanistic study of broadly neutralizing human monoclonal antibodies against dengue virus that target the fusion loop.

    ID: 1966338

    Description: epitope description:W101, L107, G109 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:mAb 4.8A

    Publication: 23077306;

  12. Mechanistic study of broadly neutralizing human monoclonal antibodies against dengue virus that target the fusion loop.

    ID: 1966339

    Description: epitope description:W101, L107, G109 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:mAb 4.8A

    Publication: 23077306;

  13. Mechanistic study of broadly neutralizing human monoclonal antibodies against dengue virus that target the fusion loop.

    ID: 1966341

    Description: epitope description:W101, L107, G109 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:mAb 4.8A

    Publication: 23077306;

  14. Mechanistic study of broadly neutralizing human monoclonal antibodies against dengue virus that target the fusion loop.

    ID: 1966343

    Description: epitope description:W101, L107, G109 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:mAb 4.8A

    Publication: 23077306;

  15. Mechanistic study of broadly neutralizing human monoclonal antibodies against dengue virus that target the fusion loop.

    ID: 1966358

    Description: epitope description:W101, G109 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:mAb D11C, mAb 1.6D

    Publication: 23077306;

  16. Mechanistic study of broadly neutralizing human monoclonal antibodies against dengue virus that target the fusion loop.

    ID: 1966359

    Description: epitope description:W101, G109 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:mAb D11C, mAb 1.6D

    Publication: 23077306;

  17. Mechanistic study of broadly neutralizing human monoclonal antibodies against dengue virus that target the fusion loop.

    ID: 1966362

    Description: epitope description:W101, G109 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:mAb D11C, mAb 1.6D

    Publication: 23077306;

  18. Broad and potent neutralization of HIV-1 by a gp41-specific human antibody.

    ID: 1966368

    Description: epitope description:NEQELLELDKWASLWNWFDITNWLWYIR antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:10E8

    Publication: 23151583;

  19. Broad and potent neutralization of HIV-1 by a gp41-specific human antibody.

    ID: 1966373

    Description: epitope description:NEQELLELDKWASLWNWFDITNWLWYIR antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:10E8

    Publication: 23151583;

  20. Broad and potent neutralization of HIV-1 by a gp41-specific human antibody.

    ID: 1966383

    Description: epitope description:NEQELLELDKWASLWNWFDITNWLWYIR antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:10E8

    Publication: 23151583;

  21. Development of AAVLP(HPV16/31L2) particles as broadly protective HPV vaccine candidate.

    ID: 1960425

    Description: epitope description:QLYKTCKQAGTCPPDIIPKV antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 22761884;

  22. Development of AAVLP(HPV16/31L2) particles as broadly protective HPV vaccine candidate.

    ID: 1960426

    Description: epitope description:QLYKTCKQAGTCPPDIIPKV antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 22761884;

  23. Development of AAVLP(HPV16/31L2) particles as broadly protective HPV vaccine candidate.

    ID: 1960429

    Description: epitope description:QLYKTCKQAGTCPPDIIPKV antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 22761884;

  24. Development of AAVLP(HPV16/31L2) particles as broadly protective HPV vaccine candidate.

    ID: 1960433

    Description: epitope description:QLYQTCKAAGTCPSDVIPKI antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 22761884;

  25. Development of AAVLP(HPV16/31L2) particles as broadly protective HPV vaccine candidate.

    ID: 1960436

    Description: epitope description:QLYKTCKQAGTCPPDIIPKV antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 22761884;

  26. Epitope spreading of the anti-CYP2D6 antibody response in patients with autoimmune hepatitis and in the CYP2D6 mouse model.

    ID: 1960441

    Description: epitope description:QRFGDI antigen name:Cytochrome P450 2D6 host organism:Mus musculus FVB

    Publication: 21795021;

  27. Epitope mapping of botulinum neurotoxins light chains.

    ID: 1960456

    Description: epitope description:DVCEYYDPDYLNT antigen name:Botulinum neurotoxin type B host organism:Oryctolagus cuniculus

    Publication: 22922018;

  28. Epitope mapping of botulinum neurotoxins light chains.

    ID: 1960457

    Description: epitope description:GSSAYYDPNYLTT antigen name:UniProt:D5VV58 host organism:Oryctolagus cuniculus

    Publication: 22922018;

  29. Epitope mapping of botulinum neurotoxins light chains.

    ID: 1960461

    Description: epitope description:GSSAYYDPNYLTT antigen name:UniProt:D5VV58 host organism:Oryctolagus cuniculus

    Publication: 22922018;

  30. Epitope mapping of botulinum neurotoxins light chains.

    ID: 1960462

    Description: epitope description:DVCEYYDPDYLNT antigen name:Botulinum neurotoxin type B host organism:Oryctolagus cuniculus

    Publication: 22922018;

  31. Immunogenetic mechanisms driving norovirus GII.4 antigenic variation.

    ID: 1960659

    Description: epitope description:A294, R297, N298, S368, E372 antigen name:Capsid protein VP1 host organism:Homo sapiens antibody name:NVB111, NVB43.9

    Publication: 22615565;

  32. Anti-hepatitis C virus E2 (HCV/E2) glycoprotein monoclonal antibodies and neutralization interference.

    ID: 1960664

    Description: epitope description:G436, W437, L438, G440, L441, F442, Y443 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:e509

    Publication: 22898087;

  33. Increased immunogenicity and protective efficacy of influenza M2e fused to a tetramerizing protein.

    ID: 1960666

    Description: epitope description:SLLTEVETPTRSEWECRCSDSSD antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 23049700;

  34. Anti-hepatitis C virus E2 (HCV/E2) glycoprotein monoclonal antibodies and neutralization interference.

    ID: 1960685

    Description: epitope description:G436, W437, L438, G440, L441, F442, Y443 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:e509

    Publication: 22898087;

  35. Anti-hepatitis C virus E2 (HCV/E2) glycoprotein monoclonal antibodies and neutralization interference.

    ID: 1960690

    Description: epitope description:G436, W437, L438, G440, L441, F442, Y443 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:e509

    Publication: 22898087;

  36. Anti-hepatitis C virus E2 (HCV/E2) glycoprotein monoclonal antibodies and neutralization interference.

    ID: 1960708

    Description: epitope description:W437, L438, L441, F442 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:e137

    Publication: 22898087;

  37. Isolation and structural characteristics of a monoclonal antibody-defined cross-reactive phospholipid antigen from Mycobacterium tuberculosis and Myco...

    ID: 1960753

    Description: epitope description:PIM2 host organism:Homo sapiens

    Publication: 1702433;

  38. Prevention of passively transferred experimental autoimmune myasthenia gravis by a phage library-derived cyclic peptide.

    ID: 1960818

    Description: epitope description:CAEPMTLPENYFSERPYHPPPPC host organism:Rattus norvegicus Lewis antibody name:198

    Publication: 10639153;

  39. Structural basis of differential neutralization of DENV-1 genotypes by an antibody that recognizes a cryptic epitope.

    ID: 1960845

    Description: epitope description:V580, M581, K614, P616, F617, S618, S619, Q620, E622, K623, G624, V625, T626, Q627, G629, R630, L631, P652, V659, A662, G663, E664...

    Publication: 23055922;

  40. Structural basis of differential neutralization of DENV-1 genotypes by an antibody that recognizes a cryptic epitope.

    ID: 1960846

    Description: epitope description:V300, M301, K334, P336, F337, S338, T339, Q340, E342, K343, G344, A345, T346, Q347, G349, R350, L351, P372, V379, A382, G383, E384...

    Publication: 23055922;

  41. Structural basis of differential neutralization of DENV-1 genotypes by an antibody that recognizes a cryptic epitope.

    ID: 1960847

    Description: epitope description:V300, M301, K334, P336, F337, S338, T339, Q340, E342, K343, G344, A345, T346, Q347, G349, R350, L351, P372, V379, A382, G383, E384...

    Publication: 23055922;

  42. Structural basis of differential neutralization of DENV-1 genotypes by an antibody that recognizes a cryptic epitope.

    ID: 1960853

    Description: epitope description:V300, M301, K334, P336, F337, S338, T339, Q340, E342, K343, G344, A345, T346, Q347, G349, R350, L351, P372, V379, A382, G383, E384...

    Publication: 23055922;

  43. Structural basis of differential neutralization of DENV-1 genotypes by an antibody that recognizes a cryptic epitope.

    ID: 1960859

    Description: epitope description:V300, M301, K334, P336, F337, S338, T339, Q340, E342, K343, G344, A345, T346, Q347, G349, R350, L351, P372, V379, A382, G383, E384...

    Publication: 23055922;

  44. Structural basis of differential neutralization of DENV-1 genotypes by an antibody that recognizes a cryptic epitope.

    ID: 1960862

    Description: epitope description:V300, M301, K334, P336, F337, S338, T339, Q340, E342, K343, G344, A345, T346, Q347, G349, R350, L351, P372, V379, A382, G383, E384...

    Publication: 23055922;

  45. Structural basis of differential neutralization of DENV-1 genotypes by an antibody that recognizes a cryptic epitope.

    ID: 1960865

    Description: epitope description:V580, M581, K614, P616, F617, S618, S619, Q620, E622, K623, G624, V625, T626, Q627, G629, R630, L631, P652, V659, A662, G663, E664...

    Publication: 23055922;

  46. Structural basis of differential neutralization of DENV-1 genotypes by an antibody that recognizes a cryptic epitope.

    ID: 1960868

    Description: epitope description:V300, M301, K334, P336, F337, S338, T339, Q340, E342, K343, G344, A345, T346, Q347, G349, R350, L351, P372, V379, A382, G383, E384...

    Publication: 23055922;

  47. Structural basis of differential neutralization of DENV-1 genotypes by an antibody that recognizes a cryptic epitope.

    ID: 1960869

    Description: epitope description:V300, M301, K334, P336, F337, S338, T339, Q340, E342, K343, G344, A345, T346, Q347, G349, R350, L351, P372, V379, A382, G383, E384...

    Publication: 23055922;

  48. Structural basis of differential neutralization of DENV-1 genotypes by an antibody that recognizes a cryptic epitope.

    ID: 1960873

    Description: epitope description:V580, M581, K614, P616, F617, S618, S619, Q620, E622, K623, G624, V625, T626, Q627, G629, R630, L631, P652, V659, A662, G663, E664...

    Publication: 23055922;

  49. Novel epitopes identified by anti-PrP monoclonal antibodies produced following immunization of Prnp0/0 Balb/cJ mice with purified scrapie prions.

    ID: 1960878

    Description: epitope description:N170, Q171, V172, Y173, Y174, R175, P176, V177, D178, Q179, Y180, S181, N185, F186, V187, H188, D189, C190, E222, Q223, M224, C225...

    Publication: 23098297;

  50. Development of AAVLP(HPV16/31L2) particles as broadly protective HPV vaccine candidate.

    ID: 1961045

    Description: epitope description:QLYQTCKAAGTCPSDVIPKI antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 22761884;

  51. LipC (Rv0220) is an immunogenic cell surface esterase of Mycobacterium tuberculosis.

    ID: 1961071

    Description: epitope description:IAVAGCSAGGHLSALAGLTA antigen name:Probable esterase LipC host organism:Homo sapiens

    Publication: 22038913;

  52. LipC (Rv0220) is an immunogenic cell surface esterase of Mycobacterium tuberculosis.

    ID: 1961073

    Description: epitope description:NDPQYQAELPEGSDTSVDAV antigen name:Probable esterase LipC host organism:Homo sapiens

    Publication: 22038913;

  53. Mapping of a B-cell epitope present in the neuraminidase of Trypanosoma cruzi.

    ID: 1961120

    Description: epitope description:DSSAHGTPSTPA antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Mus musculus C3H antibody name:TCN-2

    Publication: 1378212;

  54. Mapping of a B-cell epitope present in the neuraminidase of Trypanosoma cruzi.

    ID: 1961124

    Description: epitope description:DSSAHGTPSTPA antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Mus musculus C3H antibody name:TCN-2

    Publication: 1378212;

  55. Recognition of highly restricted regions in the beta-propeller domain of alphaIIb by platelet-associated anti-alphaIIbbeta3 autoantibodies in primary ...

    ID: 1961125

    Description: epitope description:H57, K58, D59, S60, H61, G62, R63, Q165, P166, E167, S168, G169, R170, R171 antigen name:Integrin alpha-IIb host organism:Homo sap...

    Publication: 22730538;

  56. Immunological and protective effects of diepitopic subunit dental caries vaccines.

    ID: 1961157

    Description: epitope description:DANFDSIRVDAVDNVDADLLQ antigen name:UniProt:I6TY13 host organism:Rattus norvegicus Sprague-Dawley

    Publication: 15845483;

  57. Recognition of highly restricted regions in the beta-propeller domain of alphaIIb by platelet-associated anti-alphaIIbbeta3 autoantibodies in primary ...

    ID: 1961214

    Description: epitope description:SQSLSFDSSNPEYFDGYW antigen name:Integrin alpha-IIb host organism:Homo sapiens antibody name:PA anti-alphaIIbß3 Ab

    Publication: 22730538;

  58. Synaptic protein ubiquitination in rat brain revealed by antibody-based ubiquitome analysis.

    ID: 1961245

    Description: epitope description:N(6)-(glycylglycyl)-L-lysine residue host organism:Oryctolagus cuniculus antibody name:anti-diGly

    Publication: 22871113;

  59. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961247

    Description: epitope description:NLSDNGTNGIQHAMY antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  60. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961249

    Description: epitope description:TNGIQHAMYLRGISR antigen name:Genome polyprotein host organism:Mus musculus antibody name:HC/TC 56, 57, 58, 61, 66, 69 and 126

    Publication: 22868042;

  61. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961252

    Description: epitope description:LRGISRSLHGIWPEK antigen name:Genome polyprotein host organism:Mus musculus antibody name:HC/TC 57, 61, 66 and 69

    Publication: 22868042;

  62. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961253

    Description: epitope description:ISRSLHGIWPEKICK antigen name:Genome polyprotein host organism:Mus musculus antibody name:HC/TC 69

    Publication: 22868042;

  63. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961295

    Description: epitope description:TQWNLSDNGTNGIQH antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  64. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961297

    Description: epitope description:NLSDNGTNGIQHAMY antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  65. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961308

    Description: epitope description:GVPTYLATDTELKEI antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  66. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961317

    Description: epitope description:TYLATDTELKEIQGM antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  67. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961328

    Description: epitope description:TELKEIQGMMDASEG antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  68. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961329

    Description: epitope description:KEIQGMMDASEGTNY antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  69. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961330

    Description: epitope description:KEIQGMMDASEGTNY antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  70. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961331

    Description: epitope description:KEIQGMMDASEGTNY antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  71. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961338

    Description: epitope description:ICKGVPTYLATDTEL antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  72. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961339

    Description: epitope description:ICKGVPTYLATDTEL antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  73. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961341

    Description: epitope description:QGMMDASEGTNYTCC antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  74. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961352

    Description: epitope description:IQHAMYLRGISRSLH antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  75. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961354

    Description: epitope description:AMYLRGISRSLHGIW antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  76. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961357

    Description: epitope description:LRGISRSLHGIWPEK antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  77. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961358

    Description: epitope description:ISRSLHGIWPEKICK antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  78. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961360

    Description: epitope description:SLHGIWPEKICKGVP antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  79. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961362

    Description: epitope description:GIWPEKICKGVPTYL antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  80. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961364

    Description: epitope description:DNGTNGIQHAMYLRG antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  81. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961369

    Description: epitope description:TNGIQHAMYLRGISR antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  82. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961370

    Description: epitope description:IQHAMYLRGISRSLH antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  83. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961377

    Description: epitope description:LRGISRSLHGIWPEK antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  84. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961379

    Description: epitope description:ISRSLHGIWPEKICK antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  85. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961381

    Description: epitope description:ISRSLHGIWPEKICK antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  86. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961403

    Description: epitope description:SEGTNYTCCKLQRHE antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  87. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961404

    Description: epitope description:SEGTNYTCCKLQRHE antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  88. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961405

    Description: epitope description:TCCKLQRHEWNKHGW antigen name:Genome polyprotein host organism:Mus musculus antibody name:HC/TC 56, 58, 66 and 69

    Publication: 22868042;

  89. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961412

    Description: epitope description:TCCKLQRHEWNKHGW antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  90. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961417

    Description: epitope description:KLQRHEWNKHGWCNW antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  91. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961418

    Description: epitope description:KLQRHEWNKHGWCNW antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  92. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961419

    Description: epitope description:RHEWNKHGWCNWYNI antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  93. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961432

    Description: epitope description:HGWCNWYNIDPWIQL antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  94. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961452

    Description: epitope description:VTCRYDKDADVNVVT antigen name:Genome polyprotein host organism:Mus musculus antibody name:HC/TC 126

    Publication: 22868042;

  95. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961462

    Description: epitope description:MNRTQANLAEGPPAK antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  96. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961466

    Description: epitope description:TQANLAEGPPAKECA antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  97. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961473

    Description: epitope description:EGPPAKECAVTCRYD antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  98. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961479

    Description: epitope description:PAKECAVTCRYDKDA antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  99. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961481

    Description: epitope description:PAKECAVTCRYDKDA antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  100. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961484

    Description: epitope description:ECAVTCRYDKDADVN antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston