Identification of two neutralization epitopes on the capsid protein of avian hepatitis E virus.
ID: 1477963
Description: epitope description:TVDASSGSNRFAALPAFGKPAVWGPQGAGYFYQYNSTH antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:5G10
Publication: 18198381;Identification of two neutralization epitopes on the capsid protein of avian hepatitis E virus.
ID: 1477967
Description: epitope description:HQEWIYFLQNGSSVVWYAYTNMLGQKSDTSILFEVRPIQASDQPWFLAHHTGGDDCTT antigen name:Capsid protein host organism:Mus musculus BALB/c antibody ...
Publication: 18198381;Identification of two neutralization epitopes on the capsid protein of avian hepatitis E virus.
ID: 1477968
Description: epitope description:HQEWIYFLQNGSSVVWYAYTNMLGQKSDTSILFEVRPIQASDQPWFLAHHTGGDDCTT antigen name:Capsid protein host organism:Mus musculus BALB/c antibody ...
Publication: 18198381;ID: 1477983
Description: epitope description:EQELNFPHEVLDDAA antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus
Publication: 11602751;ID: 1477991
Description: epitope description:T678, T681 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2PD11
Publication: 7523697;ID: 1482066
Description: epitope description:KYSAGGMGRRGDLEPLAARVAAQL antigen name:Genome polyprotein host organism:Bos taurus
Publication: 10075164;ID: 1482091
Description: epitope description:QKYLSSTIQKQVD antigen name:Immunodominant antigen Ov33-3 host organism:Homo sapiens antibody name:Human sera
Publication: 9325070;ID: 1482110
Description: epitope description:TTIHELLVRMKRAELYCPR antigen name:Genome polyprotein host organism:Oryctolagus cuniculus
Publication: 10075164;Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.
ID: 1482116
Description: epitope description:LEQPVSNDLS antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White
Publication: 2471791;Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.
ID: 1482119
Description: epitope description:DLYKSNHNNV antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White
Publication: 2471791;