Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961485

    Description: epitope description:ECAVTCRYDKDADVN antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  2. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961489

    Description: epitope description:VTCRYDKDADVNVVT antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  3. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961491

    Description: epitope description:VTCRYDKDADVNVVT antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  4. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961492

    Description: epitope description:VTCRYDKDADVNVVT antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  5. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961495

    Description: epitope description:VVTQARNRPTTLTGC antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  6. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961496

    Description: epitope description:VVTQARNRPTTLTGC antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  7. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961501

    Description: epitope description:RYDKDADVNVVTQAR antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  8. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961509

    Description: epitope description:KDADVNVVTQARNRP antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  9. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961513

    Description: epitope description:DVNVVTQARNRPTTL antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  10. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961514

    Description: epitope description:DVNVVTQARNRPTTL antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  11. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961515

    Description: epitope description:QARNRPTTLTGCKKG antigen name:Genome polyprotein host organism:Mus musculus antibody name:HC/TC 69

    Publication: 22868042;

  12. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961523

    Description: epitope description:QARNRPTTLTGCKKG antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  13. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961526

    Description: epitope description:NRPTTLTGCKKGKNF antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  14. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961532

    Description: epitope description:TTLTGCKKGKNFSFA antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  15. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961536

    Description: epitope description:TGCKKGKNFSFAGTV antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  16. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961542

    Description: epitope description:KKGKNFSFAGTVIEG antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  17. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961546

    Description: epitope description:KNFSFAGTVIEGPCN antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  18. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961549

    Description: epitope description:SFAGTVIEGPCNFNV antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  19. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961551

    Description: epitope description:SFAGTVIEGPCNFNV antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  20. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961553

    Description: epitope description:SFAGTVIEGPCNFNV antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  21. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961554

    Description: epitope description:GTVIEGPCNFNVSVE antigen name:Genome polyprotein host organism:Mus musculus antibody name:HC/TC 56, 57, 58, 61 and 126

    Publication: 22868042;

  22. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961562

    Description: epitope description:IEGPCNFNVSVEDIL antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  23. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961569

    Description: epitope description:PCNFNVSVEDILYGD antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  24. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961571

    Description: epitope description:PCNFNVSVEDILYGD antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 22868042;

  25. New insights into the antigenic structure of the glycoprotein E(rns) of classical swine fever virus by epitope mapping.

    ID: 1961572

    Description: epitope description:FNVSVEDILYGDHEC antigen name:Genome polyprotein host organism:Mus musculus antibody name:HC/TC 126

    Publication: 22868042;

  26. Recognition of B-cell epitopes of the 65 kDa HSP in Behçet's disease.

    ID: 1973864

    Description: epitope description:QSIGDLIAFAMDKVGNEGV antigen name:60 kDa chaperonin 2 (UniProt:P0A520) host organism:Homo sapiens

    Publication: 8668927;

  27. Differential targeting of viral components by CD4+ versus CD8+ T lymphocytes in dengue virus infection.

    ID: 1973869

    Description: epitope description:MENKAWLVHRQWFLD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 23255803;

  28. Differential targeting of viral components by CD4+ versus CD8+ T lymphocytes in dengue virus infection.

    ID: 1973875

    Description: epitope description:KKQDVVVLGSQEGAM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 23255803;

  29. Abeta1-15/16 as a potential diagnostic marker in neurodegenerative diseases.

    ID: 1973891

    Description: epitope description:DAEFRHDSGYEVHHQ antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:2B3

    Publication: 23225274;

  30. Synthesis of novel hapten and production of generic monoclonal antibody for immunoassay of penicillins residues in milk.

    ID: 1973975

    Description: epitope description:ampicillin host organism:Mus musculus BALB/c antibody name:R4M5

    Publication: 23452214;

  31. Synthesis of novel hapten and production of generic monoclonal antibody for immunoassay of penicillins residues in milk.

    ID: 1973985

    Description: epitope description:methicillin host organism:Mus musculus BALB/c antibody name:R4M5

    Publication: 23452214;

  32. Synthesis of novel hapten and production of generic monoclonal antibody for immunoassay of penicillins residues in milk.

    ID: 1973991

    Description: epitope description:oxacillin host organism:Mus musculus BALB/c antibody name:R4M5

    Publication: 23452214;

  33. Synthesis of novel hapten and production of generic monoclonal antibody for immunoassay of penicillins residues in milk.

    ID: 1973992

    Description: epitope description:oxacillin host organism:Mus musculus BALB/c antibody name:R7M9

    Publication: 23452214;

  34. Synthesis of novel hapten and production of generic monoclonal antibody for immunoassay of penicillins residues in milk.

    ID: 1973993

    Description: epitope description:nafcillin host organism:Mus musculus BALB/c antibody name:R4M5

    Publication: 23452214;

  35. Immunogenicity, efficacy, safety, and mechanism of action of epitope vaccine (Lu AF20513) for Alzheimer's disease: prelude to a clinical trial.

    ID: 1974096

    Description: epitope description:DAEFRHDSGYEV antigen name:Amyloid beta A4 protein host organism:Mus musculus APPsw

    Publication: 23486963;

  36. Immunological features and efficacy of the reconstructed epitope vaccine CtUBE against Helicobacter pylori infection in BALB/c mice model.

    ID: 1974098

    Description: epitope description:SIKEDVQF antigen name:Urease subunit beta host organism:Mus musculus BALB/c

    Publication: 23064457;

  37. Immunological features and efficacy of the reconstructed epitope vaccine CtUBE against Helicobacter pylori infection in BALB/c mice model.

    ID: 1974107

    Description: epitope description:CHHLDKSIKEDVQFADSRI antigen name:Urease subunit beta host organism:Mus musculus BALB/c

    Publication: 23064457;

  38. Immunogenicity, efficacy, safety, and mechanism of action of epitope vaccine (Lu AF20513) for Alzheimer's disease: prelude to a clinical trial.

    ID: 1974130

    Description: epitope description:DAEFRHDSGYEV antigen name:Amyloid beta A4 protein host organism:Mus musculus APPsw

    Publication: 23486963;

  39. Monoclonal IgG antibodies generated from joint-derived B cells of RA patients have a strong bias toward citrullinated autoantigen recognition.

    ID: 1974168

    Description: epitope description:KIHAREIFDSRGNPTVE + CITR(R5, R11) antigen name:Alpha-enolase host organism:Homo sapiens antibody name:1103SF-A04

    Publication: 23440041;

  40. Monoclonal IgG antibodies generated from joint-derived B cells of RA patients have a strong bias toward citrullinated autoantigen recognition.

    ID: 1974173

    Description: epitope description:KIHAREIFDSRGNPTVE + CITR(R5, R11) antigen name:Alpha-enolase host organism:Homo sapiens antibody name:1276SF-A09

    Publication: 23440041;

  41. Monoclonal IgG antibodies generated from joint-derived B cells of RA patients have a strong bias toward citrullinated autoantigen recognition.

    ID: 1974181

    Description: epitope description:KIHAREIFDSRGNPTVE + CITR(R5, R11) antigen name:Alpha-enolase host organism:Homo sapiens antibody name:1325SF-B117

    Publication: 23440041;

  42. Monoclonal IgG antibodies generated from joint-derived B cells of RA patients have a strong bias toward citrullinated autoantigen recognition.

    ID: 1974183

    Description: epitope description:KIHAREIFDSRGNPTVE + CITR(R5, R11) antigen name:Alpha-enolase host organism:Homo sapiens antibody name:1325SF-B7

    Publication: 23440041;

  43. Monoclonal IgG antibodies generated from joint-derived B cells of RA patients have a strong bias toward citrullinated autoantigen recognition.

    ID: 1974188

    Description: epitope description:KIHAREIFDSRGNPTVE + CITR(R5, R11) antigen name:Alpha-enolase host organism:Homo sapiens antibody name:1103SF-B03

    Publication: 23440041;

  44. Monoclonal IgG antibodies generated from joint-derived B cells of RA patients have a strong bias toward citrullinated autoantigen recognition.

    ID: 1974199

    Description: epitope description:KIHAREIFDSRGNPTVE + CITR(R5, R11) antigen name:Alpha-enolase host organism:Homo sapiens antibody name:1325SF-B117

    Publication: 23440041;

  45. Monoclonal IgG antibodies generated from joint-derived B cells of RA patients have a strong bias toward citrullinated autoantigen recognition.

    ID: 1974200

    Description: epitope description:KIHAREIFDSRGNPTVE + CITR(R5, R11) antigen name:Alpha-enolase host organism:Homo sapiens antibody name:1325SF-C127

    Publication: 23440041;

  46. Monoclonal IgG antibodies generated from joint-derived B cells of RA patients have a strong bias toward citrullinated autoantigen recognition.

    ID: 1974204

    Description: epitope description:NEEGFFSARGHRPLDKK + CITR(R9) antigen name:Fibrinogen beta chain host organism:Homo sapiens antibody name:1103SF-A04

    Publication: 23440041;

  47. Monoclonal IgG antibodies generated from joint-derived B cells of RA patients have a strong bias toward citrullinated autoantigen recognition.

    ID: 1974206

    Description: epitope description:NEEGFFSARGHRPLDKK + CITR(R9) antigen name:Fibrinogen beta chain host organism:Homo sapiens antibody name:1103SF-B03

    Publication: 23440041;

  48. Monoclonal IgG antibodies generated from joint-derived B cells of RA patients have a strong bias toward citrullinated autoantigen recognition.

    ID: 1974218

    Description: epitope description:NEEGFFSARGHRPLDKK + CITR(R9) antigen name:Fibrinogen beta chain host organism:Homo sapiens antibody name:1325SF-C127

    Publication: 23440041;

  49. Monoclonal IgG antibodies generated from joint-derived B cells of RA patients have a strong bias toward citrullinated autoantigen recognition.

    ID: 1974222

    Description: epitope description:NEEGFFSARGHRPLDKK + CITR(R9) antigen name:Fibrinogen beta chain host organism:Homo sapiens antibody name:1103SF-A04

    Publication: 23440041;

  50. Monoclonal IgG antibodies generated from joint-derived B cells of RA patients have a strong bias toward citrullinated autoantigen recognition.

    ID: 1974223

    Description: epitope description:NEEGFFSARGHRPLDKK + CITR(R9) antigen name:Fibrinogen beta chain host organism:Homo sapiens antibody name:1103SF-B02

    Publication: 23440041;

  51. Monoclonal IgG antibodies generated from joint-derived B cells of RA patients have a strong bias toward citrullinated autoantigen recognition.

    ID: 1974228

    Description: epitope description:NEEGFFSARGHRPLDKK + CITR(R9) antigen name:Fibrinogen beta chain host organism:Homo sapiens antibody name:1276SF-B01

    Publication: 23440041;

  52. Monoclonal IgG antibodies generated from joint-derived B cells of RA patients have a strong bias toward citrullinated autoantigen recognition.

    ID: 1974231

    Description: epitope description:NEEGFFSARGHRPLDKK + CITR(R9) antigen name:Fibrinogen beta chain host organism:Homo sapiens antibody name:1276SF-DF12

    Publication: 23440041;

  53. Monoclonal IgG antibodies generated from joint-derived B cells of RA patients have a strong bias toward citrullinated autoantigen recognition.

    ID: 1974240

    Description: epitope description:NEEGFFSARGHRPLDKK + CITR(R9) antigen name:Fibrinogen beta chain host organism:Homo sapiens antibody name:1103SF-A04

    Publication: 23440041;

  54. Monoclonal IgG antibodies generated from joint-derived B cells of RA patients have a strong bias toward citrullinated autoantigen recognition.

    ID: 1974245

    Description: epitope description:NEEGFFSARGHRPLDKK + CITR(R9) antigen name:Fibrinogen beta chain host organism:Homo sapiens antibody name:1276SF-A09

    Publication: 23440041;

  55. Monoclonal IgG antibodies generated from joint-derived B cells of RA patients have a strong bias toward citrullinated autoantigen recognition.

    ID: 1974246

    Description: epitope description:NEEGFFSARGHRPLDKK + CITR(R9) antigen name:Fibrinogen beta chain host organism:Homo sapiens antibody name:1276SF-B01

    Publication: 23440041;

  56. Monoclonal IgG antibodies generated from joint-derived B cells of RA patients have a strong bias toward citrullinated autoantigen recognition.

    ID: 1974255

    Description: epitope description:NEEGFFSARGHRPLDKK + CITR(R9) antigen name:Fibrinogen beta chain host organism:Homo sapiens antibody name:1325SF-B7

    Publication: 23440041;

  57. Monoclonal IgG antibodies generated from joint-derived B cells of RA patients have a strong bias toward citrullinated autoantigen recognition.

    ID: 1974265

    Description: epitope description:VYATRSSAVRLRSSVP + CITR(R5, R10, R12) antigen name:Vimentin host organism:Homo sapiens antibody name:1276SF-C07

    Publication: 23440041;

  58. Monoclonal IgG antibodies generated from joint-derived B cells of RA patients have a strong bias toward citrullinated autoantigen recognition.

    ID: 1974282

    Description: epitope description:VYATRSSAVRLRSSVP + CITR(R5, R10, R12) antigen name:Vimentin host organism:Homo sapiens antibody name:1276SF-B01

    Publication: 23440041;

  59. Monoclonal IgG antibodies generated from joint-derived B cells of RA patients have a strong bias toward citrullinated autoantigen recognition.

    ID: 1974304

    Description: epitope description:VYATRSSAVRLRSSVP + CITR(R5, R10, R12) antigen name:Vimentin host organism:Homo sapiens antibody name:1276SF-G08

    Publication: 23440041;

  60. The epitope of monoclonal antibodies blocking erythrocyte invasion by Plasmodium falciparum map to the dimerization and receptor glycan binding sites ...

    ID: 1974327

    Description: epitope description:NMVPLWR host organism:Mus musculus BALB/c antibody name:R256

    Publication: 23457550;

  61. The epitope of monoclonal antibodies blocking erythrocyte invasion by Plasmodium falciparum map to the dimerization and receptor glycan binding sites ...

    ID: 1974332

    Description: epitope description:HSNSSWISRQTY host organism:Mus musculus BALB/c antibody name:R216

    Publication: 23457550;

  62. The epitope of monoclonal antibodies blocking erythrocyte invasion by Plasmodium falciparum map to the dimerization and receptor glycan binding sites ...

    ID: 1974333

    Description: epitope description:GNSLHNYPRGPT host organism:Mus musculus BALB/c antibody name:R216

    Publication: 23457550;

  63. The epitope of monoclonal antibodies blocking erythrocyte invasion by Plasmodium falciparum map to the dimerization and receptor glycan binding sites ...

    ID: 1974334

    Description: epitope description:TRPFEPIQALFK host organism:Mus musculus BALB/c antibody name:R216

    Publication: 23457550;

  64. The epitope of monoclonal antibodies blocking erythrocyte invasion by Plasmodium falciparum map to the dimerization and receptor glycan binding sites ...

    ID: 1974335

    Description: epitope description:VKLHPSSLVSLN host organism:Mus musculus BALB/c antibody name:R216

    Publication: 23457550;

  65. Crystal structure of alpha5beta1 integrin ectodomain: atomic details of the fibronectin receptor.

    ID: 1974358

    Description: epitope description:N97, R98, S99, K100, G101, T102, A103, E104, K105, E139, D140, N171, R174, R175, I176, T177, S178, S419, I420 antigen name:Integri...

    Publication: 22451694;

  66. Crystal structure of alpha5beta1 integrin ectodomain: atomic details of the fibronectin receptor.

    ID: 1974361

    Description: epitope description:N97, R98, S99, K100, G101, T102, A103, E104, K105, E139, D140, N171, R174, R175, I176, T177, S178, S419, I420 antigen name:Integri...

    Publication: 22451694;

  67. Plasmodium berghei sporozoite challenge of vaccinated BALB/c mice leads to the induction of humoral immunity and improved function of CD8(+) memory T ...

    ID: 1974372

    Description: epitope description:PGGNNNNKNNNNDDSYIPSAEKILEFVKQI antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus BALB/c

    Publication: 23229763;

  68. The N-terminal sequence of prion protein consists an epitope specific to the abnormal isoform of prion protein (PrP(Sc)).

    ID: 1974401

    Description: epitope description:QGSPGGN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:6A12

    Publication: 23469131;

  69. The epitope of monoclonal antibodies blocking erythrocyte invasion by Plasmodium falciparum map to the dimerization and receptor glycan binding sites ...

    ID: 1974402

    Description: epitope description:VWECKKPYKLSTKDVCVPP antigen name:Erythrocyte binding antigen 175 host organism:Mus musculus BALB/c antibody name:R217

    Publication: 23457550;

  70. Stable coordination of the inhibitory Ca2+ ion at the metal ion-dependent adhesion site in integrin CD11b/CD18 by an antibody-derived ligand aspartate...

    ID: 1974406

    Description: epitope description:S158, G159, S160, E194, E195, F196, R197, L221, L222, G223, R224, T225, G259, E260, F262, G263, A290 antigen name:Integrin alpha-M...

    Publication: 22095715;

  71. Stable coordination of the inhibitory Ca2+ ion at the metal ion-dependent adhesion site in integrin CD11b/CD18 by an antibody-derived ligand aspartate...

    ID: 1974416

    Description: epitope description:S158, G159, S160, E194, E195, F196, R197, L221, L222, G223, R224, T225, G259, E260, F262, G263, A290 antigen name:Integrin alpha-M...

    Publication: 22095715;

  72. The N-terminal sequence of prion protein consists an epitope specific to the abnormal isoform of prion protein (PrP(Sc)).

    ID: 1974417

    Description: epitope description:WNTGGSRYP antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:8D5

    Publication: 23469131;

  73. The N-terminal sequence of prion protein consists an epitope specific to the abnormal isoform of prion protein (PrP(Sc)).

    ID: 1974419

    Description: epitope description:DYEDRYYRE antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:6H4

    Publication: 23469131;

  74. The N-terminal sequence of prion protein consists an epitope specific to the abnormal isoform of prion protein (PrP(Sc)).

    ID: 1974421

    Description: epitope description:QGSPGGN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:6A12

    Publication: 23469131;

  75. The N-terminal sequence of prion protein consists an epitope specific to the abnormal isoform of prion protein (PrP(Sc)).

    ID: 1974422

    Description: epitope description:DYEDRYYRE antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:6H4

    Publication: 23469131;

  76. The N-terminal sequence of prion protein consists an epitope specific to the abnormal isoform of prion protein (PrP(Sc)).

    ID: 1974423

    Description: epitope description:WNTGGSRYP antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:8D5

    Publication: 23469131;

  77. Sub-domains of ricin's B subunit as targets of toxin neutralizing and non-neutralizing monoclonal antibodies.

    ID: 1974453

    Description: epitope description:WNWDPFSWHLPE host organism:Mus musculus BALB/c antibody name:B/J F9

    Publication: 22984492;

  78. Sub-domains of ricin's B subunit as targets of toxin neutralizing and non-neutralizing monoclonal antibodies.

    ID: 1974466

    Description: epitope description:QDIMKFLTVNWV host organism:Mus musculus BALB/c antibody name:B/J F9

    Publication: 22984492;

  79. Sub-domains of ricin's B subunit as targets of toxin neutralizing and non-neutralizing monoclonal antibodies.

    ID: 1974478

    Description: epitope description:WHWNPWTLGKVA host organism:Mus musculus BALB/c antibody name:B/J F9

    Publication: 22984492;

  80. Sub-domains of ricin's B subunit as targets of toxin neutralizing and non-neutralizing monoclonal antibodies.

    ID: 1974481

    Description: epitope description:WHWDPYSGTEVK host organism:Mus musculus BALB/c antibody name:B/J F9

    Publication: 22984492;

  81. Sub-domains of ricin's B subunit as targets of toxin neutralizing and non-neutralizing monoclonal antibodies.

    ID: 1974489

    Description: epitope description:WTWAPHSGQKGL host organism:Mus musculus BALB/c

    Publication: 22984492;

  82. Sub-domains of ricin's B subunit as targets of toxin neutralizing and non-neutralizing monoclonal antibodies.

    ID: 1974498

    Description: epitope description:WQLTHGRSEIIY host organism:Mus musculus BALB/c antibody name:B/J F9

    Publication: 22984492;

  83. Sub-domains of ricin's B subunit as targets of toxin neutralizing and non-neutralizing monoclonal antibodies.

    ID: 1974501

    Description: epitope description:WSLTYDMLQYQS host organism:Mus musculus BALB/c

    Publication: 22984492;

  84. Structural insights into the down-regulation of overexpressed p185(her2/neu) protein of transformed cells by the antibody chA21.

    ID: 1974506

    Description: epitope description:P122, N124, N125, T126, R157, N158, P159, C162, Y163, D165, T166, N187, R188, S189, R190, A191, C192, H193, P194, S196, P197, E207...

    Publication: 21680730;

  85. A virus-like particle that elicits cross-reactive antibodies to the conserved stem of influenza virus hemagglutinin.

    ID: 1974596

    Description: epitope description:KSTQNAIDGITNKVNSVIEK antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 22896619;

  86. A virus-like particle that elicits cross-reactive antibodies to the conserved stem of influenza virus hemagglutinin.

    ID: 1974604

    Description: epitope description:KSTQNAINGITNKVNSVIEK antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 22896619;

  87. Immunogenic properties of amyloid beta oligomers.

    ID: 1974613

    Description: epitope description:FFAEDVGSNKGAI antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c

    Publication: 23432787;

  88. Construction of a bovine enterovirus-based vector expressing a foot-and-mouth disease virus epitope.

    ID: 1974624

    Description: epitope description:VANVRGDLQVLAQKAARALP antigen name:Polyprotein host organism:Mus musculus

    Publication: 23391822;

  89. Construction of a bovine enterovirus-based vector expressing a foot-and-mouth disease virus epitope.

    ID: 1974626

    Description: epitope description:VANVRGDLQVLAQKAARALP antigen name:Polyprotein host organism:Oryctolagus cuniculus

    Publication: 23391822;

  90. Structural and functional characterization of an agonistic anti-human EphA2 monoclonal antibody.

    ID: 1974631

    Description: epitope description:N57, M66, S68, C70, V72, M73, R103, S107, F108, P109, S153, F156, E157, R159, C188, V189, A190 antigen name:Ephrin type-A receptor...

    Publication: 21867711;

  91. Structural and functional characterization of an agonistic anti-human EphA2 monoclonal antibody.

    ID: 1974633

    Description: epitope description:N57, M66, S68, C70, V72, M73, R103, S107, F108, P109, S153, F156, E157, R159, C188, V189, A190 antigen name:Ephrin type-A receptor...

    Publication: 21867711;

  92. Anti-cardiolipin and anti-beta 2-glycoprotein I antibodies in celiac disease.

    ID: 1974655

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 21839587;

  93. Anti-cardiolipin and anti-beta 2-glycoprotein I antibodies in celiac disease.

    ID: 1974656

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 21839587;

  94. Rapid screening and identification of dominant B cell epitopes of HBV surface antigen by quantum dot-based fluorescence polarization assay.

    ID: 1974662

    Description: epitope description:PHGGLLGW antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 23452727;

  95. Rapid screening and identification of dominant B cell epitopes of HBV surface antigen by quantum dot-based fluorescence polarization assay.

    ID: 1974665

    Description: epitope description:QDSRVRALYLPA antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 23452727;

  96. An alpaca nanobody inhibits hepatitis C virus entry and cell-to-cell transmission.

    ID: 1977812

    Description: epitope description:N415, G523, T526 antigen name:Genome polyprotein host organism:Vicugna pacos antibody name:D03

    Publication: 23553604;

  97. Identification and characterization of antigenic epitope of Staphylococcus aureus ClfA adhesin.

    ID: 1977815

    Description: epitope description:AKSFMPSLVMSQ host organism:Mus musculus BALB/c

    Publication: 23178048;

  98. An alpaca nanobody inhibits hepatitis C virus entry and cell-to-cell transmission.

    ID: 1977817

    Description: epitope description:N415, G523, T526 antigen name:Genome polyprotein host organism:Vicugna pacos antibody name:D03

    Publication: 23553604;

  99. An alpaca nanobody inhibits hepatitis C virus entry and cell-to-cell transmission.

    ID: 1977822

    Description: epitope description:N415, G523, T526 antigen name:Genome polyprotein host organism:Vicugna pacos antibody name:D03

    Publication: 23553604;

  100. Somatic mutations of the immunoglobulin framework are generally required for broad and potent HIV-1 neutralization.

    ID: 1977831

    Description: epitope description:L121, T280, N281, N282, A283, K284, S365, G366, G367, D368, E370, I371, N419, W421, G423, G425, Q426, T449, R450, D451, G452, G453...

    Publication: 23540694;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston