Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Synthesis, characterization and immunochemical evaluation of cephalosporin antigenic determinants.

    ID: 1695859

    Description: epitope description:amoxicillin host organism:Homo sapiens

    Publication: 12833570;

  2. Synthesis, characterization and immunochemical evaluation of cephalosporin antigenic determinants.

    ID: 1695860

    Description: epitope description:amoxicillin host organism:Homo sapiens

    Publication: 12833570;

  3. Synthesis, characterization and immunochemical evaluation of cephalosporin antigenic determinants.

    ID: 1695863

    Description: epitope description:ceftazidime host organism:Homo sapiens

    Publication: 12833570;

  4. Conformational epitopes on the diabetes autoantigen GAD65 identified by peptide phage display and molecular modeling.

    ID: 1695901

    Description: epitope description:LRKKGYDPG host organism:Homo sapiens antibody name:MICA3

    Publication: 11034389;

  5. Conformational epitopes on the diabetes autoantigen GAD65 identified by peptide phage display and molecular modeling.

    ID: 1695902

    Description: epitope description:SRKKTFTGA host organism:Homo sapiens antibody name:MICA3

    Publication: 11034389;

  6. Conformational epitopes on the diabetes autoantigen GAD65 identified by peptide phage display and molecular modeling.

    ID: 1695904

    Description: epitope description:GRKSAVSPA host organism:Homo sapiens antibody name:MICA3

    Publication: 11034389;

  7. Conformational epitopes on the diabetes autoantigen GAD65 identified by peptide phage display and molecular modeling.

    ID: 1695907

    Description: epitope description:HKKSLSSPS host organism:Homo sapiens antibody name:MICA3

    Publication: 11034389;

  8. Conformational epitopes on the diabetes autoantigen GAD65 identified by peptide phage display and molecular modeling.

    ID: 1695908

    Description: epitope description:RRKPGTEQL host organism:Homo sapiens antibody name:MICA3

    Publication: 11034389;

  9. Conformational epitopes on the diabetes autoantigen GAD65 identified by peptide phage display and molecular modeling.

    ID: 1695910

    Description: epitope description:YKKGARPIQ host organism:Homo sapiens antibody name:MICA3

    Publication: 11034389;

  10. Conformational epitopes on the diabetes autoantigen GAD65 identified by peptide phage display and molecular modeling.

    ID: 1695916

    Description: epitope description:RKKKPPGLA host organism:Homo sapiens antibody name:MICA4

    Publication: 11034389;

  11. Conformational epitopes on the diabetes autoantigen GAD65 identified by peptide phage display and molecular modeling.

    ID: 1695921

    Description: epitope description:MRKSTGTAS host organism:Homo sapiens antibody name:MICA4

    Publication: 11034389;

  12. Conformational epitopes on the diabetes autoantigen GAD65 identified by peptide phage display and molecular modeling.

    ID: 1695923

    Description: epitope description:VRKLTVTSA host organism:Homo sapiens antibody name:MICA4

    Publication: 11034389;

  13. Conformational epitopes on the diabetes autoantigen GAD65 identified by peptide phage display and molecular modeling.

    ID: 1695924

    Description: epitope description:KKTKGLVTT host organism:Homo sapiens antibody name:MICA4

    Publication: 11034389;

  14. Conformational epitopes on the diabetes autoantigen GAD65 identified by peptide phage display and molecular modeling.

    ID: 1695925

    Description: epitope description:KSVKPRQAT host organism:Homo sapiens antibody name:MICA4

    Publication: 11034389;

  15. DNA beta-amyloid(1-42) trimer immunization for Alzheimer disease in a wild-type mouse model.

    ID: 1695994

    Description: epitope description:FRHDSGY antigen name:Amyloid beta A4 protein host organism:Mus musculus C57BL/6 x SJL

    Publication: 19861672;

  16. Antibody binding site mapping of SARS-CoV spike protein receptor-binding domain by a combination of yeast surface display and phage peptide library sc...

    ID: 1696012

    Description: epitope description:SNVYADSFVVKGDDVRQIAP antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:S1

    Publication: 19951177;

  17. Antibody binding site mapping of SARS-CoV spike protein receptor-binding domain by a combination of yeast surface display and phage peptide library sc...

    ID: 1696013

    Description: epitope description:VYAWERKKISNCVADYSVLYNSTF antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:S1

    Publication: 19951177;

  18. Antibody binding site mapping of SARS-CoV spike protein receptor-binding domain by a combination of yeast surface display and phage peptide library sc...

    ID: 1696016

    Description: epitope description:VYAWERKKISNCVADYSVLYNSTF antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:S1

    Publication: 19951177;

  19. A measles-derived peptide treats and vaccinates against adjuvant arthritis.

    ID: 1696019

    Description: epitope description:SRFGWFENKE antigen name:Nucleoprotein host organism:Rattus norvegicus Lewis

    Publication: 19124087;

  20. Insights into native epitopes of proliferating cell nuclear antigen using recombinant DNA protein products.

    ID: 1696091

    Description: epitope description:SSSGVNLQSMDSSHV antigen name:Proliferating cell nuclear antigen host organism:Homo sapiens

    Publication: 1695666;

  21. Insights into native epitopes of proliferating cell nuclear antigen using recombinant DNA protein products.

    ID: 1696093

    Description: epitope description:TLRSEGFDTYRCDRN antigen name:Proliferating cell nuclear antigen host organism:Homo sapiens

    Publication: 1695666;

  22. Insights into native epitopes of proliferating cell nuclear antigen using recombinant DNA protein products.

    ID: 1696094

    Description: epitope description:RCDRNLAMGVNLTSM antigen name:Proliferating cell nuclear antigen host organism:Homo sapiens

    Publication: 1695666;

  23. Insights into native epitopes of proliferating cell nuclear antigen using recombinant DNA protein products.

    ID: 1696122

    Description: epitope description:VSDYEMKLMDLDVEQ antigen name:Proliferating cell nuclear antigen host organism:Mus musculus BALB/c antibody name:19A2

    Publication: 1695666;

  24. Synthetic compound peptide simulating antigenicity of conformation-dependent autoepitope.

    ID: 1696125

    Description: epitope description:ILKKVLEALKDLINE antigen name:Proliferating cell nuclear antigen host organism:Oryctolagus cuniculus

    Publication: 7518436;

  25. Synthetic compound peptide simulating antigenicity of conformation-dependent autoepitope.

    ID: 1696127

    Description: epitope description:RAEDNADTLALVFEA antigen name:Proliferating cell nuclear antigen host organism:Oryctolagus cuniculus

    Publication: 7518436;

  26. Synthetic compound peptide simulating antigenicity of conformation-dependent autoepitope.

    ID: 1696136

    Description: epitope description:LDVEQLGIPEQEYSC antigen name:Proliferating cell nuclear antigen host organism:Oryctolagus cuniculus

    Publication: 7518436;

  27. Synthetic compound peptide simulating antigenicity of conformation-dependent autoepitope.

    ID: 1696139

    Description: epitope description:QEYSCVVKMPSGEFA antigen name:Proliferating cell nuclear antigen host organism:Oryctolagus cuniculus

    Publication: 7518436;

  28. Reactivity of autoantibodies in systemic lupus erythematosus with synthetic core histone peptides.

    ID: 1691061

    Description: epitope description:PATGGVKKPHRYRPGT antigen name:Histone H3.1 host organism:Homo sapiens

    Publication: 2474514;

  29. Reactivity of autoantibodies in systemic lupus erythematosus with synthetic core histone peptides.

    ID: 1691073

    Description: epitope description:VHPDTGISSKAMGIMN antigen name:Histone H2B type 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2474514;

  30. Anti-SSA/Ro52 autoantibodies blocking the cardiac 5-HT4 serotoninergic receptor could explain neonatal lupus congenital heart block.

    ID: 1691076

    Description: epitope description:RKGHFLLSSKSGFWTIWL antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 11069058;

  31. High affinity cross-reacting mAb generated by minimal mimicry: implications for the pathogenesis of anti-nuclear autoantibodies and immunosuppression.

    ID: 1691090

    Description: epitope description:GGAHFSVSSLAEG antigen name:X-ray repair cross-complementing protein 5 host organism:Mus musculus antibody name:2E1

    Publication: 9520450;

  32. High affinity cross-reacting mAb generated by minimal mimicry: implications for the pathogenesis of anti-nuclear autoantibodies and immunosuppression.

    ID: 1691092

    Description: epitope description:GGAHFSVSSLAEG antigen name:X-ray repair cross-complementing protein 5 host organism:Mus musculus antibody name:2E1

    Publication: 9520450;

  33. High affinity cross-reacting mAb generated by minimal mimicry: implications for the pathogenesis of anti-nuclear autoantibodies and immunosuppression.

    ID: 1691094

    Description: epitope description:GSFSDADLAD antigen name:CD99 antigen host organism:Mus musculus antibody name:2E1

    Publication: 9520450;

  34. Picornavirus proteins share antigenic determinants with heat shock proteins 60/65.

    ID: 1691097

    Description: epitope description:KEVPALTAVETGAT antigen name:Genome polyprotein host organism:Oryctolagus cuniculus antibody name:13

    Publication: 11055249;

  35. High affinity cross-reacting mAb generated by minimal mimicry: implications for the pathogenesis of anti-nuclear autoantibodies and immunosuppression.

    ID: 1691100

    Description: epitope description:GGAHFSVSSLAEG antigen name:X-ray repair cross-complementing protein 5 host organism:Mus musculus antibody name:2E1

    Publication: 9520450;

  36. High affinity cross-reacting mAb generated by minimal mimicry: implications for the pathogenesis of anti-nuclear autoantibodies and immunosuppression.

    ID: 1691102

    Description: epitope description:GGAHFSVSSLAEG antigen name:X-ray repair cross-complementing protein 5 host organism:Mus musculus antibody name:2E1

    Publication: 9520450;

  37. Reactivity of autoantibodies in systemic lupus erythematosus with synthetic core histone peptides.

    ID: 1691117

    Description: epitope description:MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGN antigen name:Histone H2A type 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2474514;

  38. B and T cell responses to the spliceosomal heterogeneous nuclear ribonucleoproteins A2 and B1 in normal and lupus mice.

    ID: 1691177

    Description: epitope description:LTDCVVMRDPASKRSRGFGFV antigen name:Heterogeneous nuclear ribonucleoproteins A2/B1 host organism:Mus musculus CBA

    Publication: 10925319;

  39. B and T cell responses to the spliceosomal heterogeneous nuclear ribonucleoproteins A2 and B1 in normal and lupus mice.

    ID: 1691192

    Description: epitope description:AAMAARPHSIDGRVVEPKRAV antigen name:Heterogeneous nuclear ribonucleoproteins A2/B1 host organism:Mus musculus MLR/lpr

    Publication: 10925319;

  40. B and T cell responses to the spliceosomal heterogeneous nuclear ribonucleoproteins A2 and B1 in normal and lupus mice.

    ID: 1691193

    Description: epitope description:AAMAARPHSIDGRVVEPKRAV antigen name:Heterogeneous nuclear ribonucleoproteins A2/B1 host organism:Mus musculus CBA

    Publication: 10925319;

  41. B and T cell responses to the spliceosomal heterogeneous nuclear ribonucleoproteins A2 and B1 in normal and lupus mice.

    ID: 1691224

    Description: epitope description:DTEEHHLRDYFEEYGKIDTIE antigen name:Heterogeneous nuclear ribonucleoproteins A2/B1 host organism:Mus musculus MLR/lpr

    Publication: 10925319;

  42. B and T cell responses to the spliceosomal heterogeneous nuclear ribonucleoproteins A2 and B1 in normal and lupus mice.

    ID: 1691240

    Description: epitope description:KRGFGFVTFDDHDPVDKIVLQ antigen name:Heterogeneous nuclear ribonucleoproteins A2/B1 host organism:Mus musculus MLR/lpr

    Publication: 10925319;

  43. Identification of human autoantibodies to the DNA ligase IV/XRCC4 complex and mapping of an autoimmune epitope to a potential regulatory region.

    ID: 1691289

    Description: epitope description:VSKDDSIISSLDVTD antigen name:DNA repair protein XRCC4 host organism:Homo sapiens

    Publication: 12218164;

  44. T cell help is required to induce idiotypic-anti-idiotypic autoantibody network after immunization with complementary epitope 289-308aa of La/SSB auto...

    ID: 1691294

    Description: epitope description:ANNGNLQLRNKEVTWEVLEG antigen name:Lupus La protein host organism:Mus musculus BALB/c

    Publication: 15008973;

  45. Histone peptide-induced nasal tolerance: suppression of murine lupus.

    ID: 1691297

    Description: epitope description:TYTEHAKRKTVTAMDVVYALKRQ antigen name:Histone H4 host organism:Mus musculus SNF1

    Publication: 12097422;

  46. Involvement of molecular mimicry between human T-cell leukemia virus type 1 gp46 and osteoprotegerin in induction of hypercalcemia.

    ID: 1691386

    Description: epitope description:KLLTLVQLTLQS antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus Japanese white

    Publication: 19134004;

  47. Involvement of molecular mimicry between human T-cell leukemia virus type 1 gp46 and osteoprotegerin in induction of hypercalcemia.

    ID: 1691391

    Description: epitope description:DHILEPSIPWKS antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 19134004;

  48. Involvement of molecular mimicry between human T-cell leukemia virus type 1 gp46 and osteoprotegerin in induction of hypercalcemia.

    ID: 1691394

    Description: epitope description:WKSKLLTLVQLT antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 19134004;

  49. B and T cell responses to the spliceosomal heterogeneous nuclear ribonucleoproteins A2 and B1 in normal and lupus mice.

    ID: 1691406

    Description: epitope description:RGFGFVTFSSMAEVDAAMAAR antigen name:Heterogeneous nuclear ribonucleoproteins A2/B1 host organism:Mus musculus MRL

    Publication: 10925319;

  50. B and T cell responses to the spliceosomal heterogeneous nuclear ribonucleoproteins A2 and B1 in normal and lupus mice.

    ID: 1691408

    Description: epitope description:KIDTIEIITDRQSGKKRGFGFV antigen name:Heterogeneous nuclear ribonucleoproteins A2/B1 host organism:Mus musculus MLR/lpr

    Publication: 10925319;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston