Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482166

    Description: epitope description:DLYKSNHNNV antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  2. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482168

    Description: epitope description:SCTVTREDGT antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  3. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482170

    Description: epitope description:NPDREYDFRD antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  4. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482184

    Description: epitope description:SCTVTREDGT antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  5. Antigenic analysis of bean pod mottle virus using linear and cyclized synthetic peptides.

    ID: 1482195

    Description: epitope description:AFSVPQANARSSENAESSA antigen name:RNA2 polyprotein host organism:Oryctolagus cuniculus antibody name:anti-BPMV

    Publication: 7679572;

  6. Enhanced immunogenicity of a conformational epitope of human T-lymphotropic virus type 1 using a novel chimeric peptide.

    ID: 1482202

    Description: epitope description:FLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSKLLTLVQLTL antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zeala...

    Publication: 11137241;

  7. Enhanced immunogenicity of a conformational epitope of human T-lymphotropic virus type 1 using a novel chimeric peptide.

    ID: 1482203

    Description: epitope description:FLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSKLLTLVQLTL antigen name:Envelope glycoprotein gp62 host organism:Mus musculus ICR

    Publication: 11137241;

  8. Type-independent detection of foot-and-mouth disease virus by monoclonal antibodies that bind to amino-terminal residues of capsid protein VP2.

    ID: 1482213

    Description: epitope description:ETTLLEDRILTTRNG antigen name:Genome polyprotein host organism:Mus musculus antibody name:13A6

    Publication: 11226567;

  9. Type-independent detection of foot-and-mouth disease virus by monoclonal antibodies that bind to amino-terminal residues of capsid protein VP2.

    ID: 1482215

    Description: epitope description:DKKTEETTLLEDRIL antigen name:Genome polyprotein host organism:Mus musculus antibody name:13A6

    Publication: 11226567;

  10. Type-independent detection of foot-and-mouth disease virus by monoclonal antibodies that bind to amino-terminal residues of capsid protein VP2.

    ID: 1482221

    Description: epitope description:DKKTEETTLLEDRIL antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:15F7

    Publication: 11226567;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston