Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. The epitope of monoclonal antibodies blocking erythrocyte invasion by Plasmodium falciparum map to the dimerization and receptor glycan binding sites ...

    ID: 1975550

    Description: epitope description:VWECKKPYKLSTKDVCVPP antigen name:Erythrocyte binding antigen 175 host organism:Mus musculus BALB/c antibody name:R217

    Publication: 23457550;

  2. The epitope of monoclonal antibodies blocking erythrocyte invasion by Plasmodium falciparum map to the dimerization and receptor glycan binding sites ...

    ID: 1975551

    Description: epitope description:VWECKKPYKLSTKDVCVPP antigen name:Erythrocyte binding antigen 175 host organism:Mus musculus BALB/c antibody name:R217

    Publication: 23457550;

  3. Identification of galactose-alpha-1,3-galactose in the gastrointestinal tract of the tick Ixodes ricinus; possible relationship with red meat all...

    ID: 1975561

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Mus musculus antibody name:anti-alpha-Gal (M86)

    Publication: 23414348;

  4. Identification of galactose-alpha-1,3-galactose in the gastrointestinal tract of the tick Ixodes ricinus; possible relationship with red meat all...

    ID: 1975565

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Homo sapiens

    Publication: 23414348;

  5. Recombinant yellow fever viruses elicit CD8+ T cell responses and protective immunity against Trypanosoma cruzi.

    ID: 1975599

    Description: epitope description:TEWETGQI antigen name:Trans-sialidase, putative (UniProt:K4DXB0) host organism:Mus musculus A/J

    Publication: 23527169;

  6. Synthesis of a single-molecule L-rhamnose-containing three-component vaccine and evaluation of antigenicity in the presence of anti-L-rhamnose antibod...

    ID: 1975641

    Description: epitope description:O-(N-acetyl-alpha-D-galactosaminyl)-L-threonino group host organism:Mus musculus BALB/c

    Publication: 21080675;

  7. A nonallergenic birch pollen allergy vaccine consisting of hepatitis PreS-fused Bet v 1 peptides focuses blocking IgG toward IgE epitopes and shifts i...

    ID: 1975734

    Description: epitope description:PEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIK antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 23440415;

  8. Cooperativity between CD8+ T cells, non-neutralizing antibodies, and alveolar macrophages is important for heterosubtypic influenza virus immunity.

    ID: 1975737

    Description: epitope description:KAVYNFATC antigen name:Pre-glycoprotein polyprotein GP complex host organism:Mus musculus C57BL/6

    Publication: 23516357;

  9. A nonallergenic birch pollen allergy vaccine consisting of hepatitis PreS-fused Bet v 1 peptides focuses blocking IgG toward IgE epitopes and shifts i...

    ID: 1975762

    Description: epitope description:LFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDE antigen name:Bet v 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 23440415;

  10. A nonallergenic birch pollen allergy vaccine consisting of hepatitis PreS-fused Bet v 1 peptides focuses blocking IgG toward IgE epitopes and shifts i...

    ID: 1975768

    Description: epitope description:PEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIK antigen name:Bet v 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 23440415;

  11. A nonallergenic birch pollen allergy vaccine consisting of hepatitis PreS-fused Bet v 1 peptides focuses blocking IgG toward IgE epitopes and shifts i...

    ID: 1975769

    Description: epitope description:PEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIK antigen name:Bet v 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 23440415;

  12. A nonallergenic birch pollen allergy vaccine consisting of hepatitis PreS-fused Bet v 1 peptides focuses blocking IgG toward IgE epitopes and shifts i...

    ID: 1975774

    Description: epitope description:LFPKVAPQAISSVENIEGNGGPGTIKKISF antigen name:Bet v 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 23440415;

  13. A nonallergenic birch pollen allergy vaccine consisting of hepatitis PreS-fused Bet v 1 peptides focuses blocking IgG toward IgE epitopes and shifts i...

    ID: 1975779

    Description: epitope description:GPGTIKKISFPEGFPFKYVKDRVDEVDHTN antigen name:Bet v 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 23440415;

  14. A nonallergenic birch pollen allergy vaccine consisting of hepatitis PreS-fused Bet v 1 peptides focuses blocking IgG toward IgE epitopes and shifts i...

    ID: 1975780

    Description: epitope description:GPGTIKKISFPEGFPFKYVKDRVDEVDHTN antigen name:Bet v 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 23440415;

  15. A nonallergenic birch pollen allergy vaccine consisting of hepatitis PreS-fused Bet v 1 peptides focuses blocking IgG toward IgE epitopes and shifts i...

    ID: 1975781

    Description: epitope description:VDHTNFKYNYSVIEGGPIGDTLEKISNEIK antigen name:Bet v 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 23440415;

  16. A nonallergenic birch pollen allergy vaccine consisting of hepatitis PreS-fused Bet v 1 peptides focuses blocking IgG toward IgE epitopes and shifts i...

    ID: 1975784

    Description: epitope description:LFPKVAPQAISSVENIEGNGGPGTIKKISF antigen name:Bet v 1 host organism:Mus musculus BALB/c antibody name:mAb2

    Publication: 23440415;

  17. Local and systemic immune responses in mice to intranasal delivery of peptides representing bovine respiratory syncytial virus epitopes encapsulated i...

    ID: 1975830

    Description: epitope description:STCEGNLACLSLSK host organism:Mus musculus BALB/c

    Publication: 23312498;

  18. A novel B cell epitope in cold-shock DEAD-box protein A from Mycobacterium tuberculosis.

    ID: 1975836

    Description: epitope description:APDPPLSRR antigen name:ATP-dependent RNA helicase DeaD host organism:Mus musculus BALB/c antibody name:A3G5

    Publication: 23261158;

  19. A novel B cell epitope in cold-shock DEAD-box protein A from Mycobacterium tuberculosis.

    ID: 1975837

    Description: epitope description:APDPPLSRR antigen name:ATP-dependent RNA helicase DeaD host organism:Mus musculus BALB/c

    Publication: 23261158;

  20. Epitope-based vaccines with the Anaplasma marginale MSP1a functional motif induce a balanced humoral and cellular immune response in mice.

    ID: 1975843

    Description: epitope description:STSSQL antigen name:Major surface protein 1a (MSP1A) host organism:Mus musculus BALB/c

    Publication: 23579784;

  21. Characterization of a single-chain variable fragment recognizing a linear epitope of abeta: a biotechnical tool for studies on Alzheimer's disease?

    ID: 1975862

    Description: epitope description:DAEFRHDS antigen name:Amyloid beta A4 protein host organism:Mus musculus PrP null antibody name:scFv-IC16

    Publication: 23555792;

  22. Characterization of a single-chain variable fragment recognizing a linear epitope of abeta: a biotechnical tool for studies on Alzheimer's disease?

    ID: 1975873

    Description: epitope description:DAEFRHDS antigen name:Amyloid beta A4 protein host organism:Mus musculus PrP null antibody name:IC16

    Publication: 23555792;

  23. Characterization of a single-chain variable fragment recognizing a linear epitope of abeta: a biotechnical tool for studies on Alzheimer's disease?

    ID: 1975874

    Description: epitope description:DAEFRHDS antigen name:Amyloid beta A4 protein host organism:Mus musculus PrP null antibody name:IC16

    Publication: 23555792;

  24. Characterization of a single-chain variable fragment recognizing a linear epitope of abeta: a biotechnical tool for studies on Alzheimer's disease?

    ID: 1975875

    Description: epitope description:DAEFRHDS antigen name:Amyloid beta A4 protein host organism:Mus musculus PrP null antibody name:IC16

    Publication: 23555792;

  25. Characterization of a single-chain variable fragment recognizing a linear epitope of abeta: a biotechnical tool for studies on Alzheimer's disease?

    ID: 1975877

    Description: epitope description:DAEFRHDS antigen name:Amyloid beta A4 protein host organism:Mus musculus PrP null antibody name:IC16

    Publication: 23555792;

  26. Outer surface protein C peptide derived from Borrelia burgdorferi sensu stricto as a target for serodiagnosis of early lyme disease.

    ID: 1975903

    Description: epitope description:GNTSANSADESVKGP antigen name:Other Borreliella burgdorferi (Lyme disease spirochete) protein host organism:Homo sapiens

    Publication: 23365204;

  27. Outer surface protein C peptide derived from Borrelia burgdorferi sensu stricto as a target for serodiagnosis of early lyme disease.

    ID: 1975909

    Description: epitope description:VLAVKEIETLLASID antigen name:Other Borreliella burgdorferi (Lyme disease spirochete) protein host organism:Homo sapiens

    Publication: 23365204;

  28. Outer surface protein C peptide derived from Borrelia burgdorferi sensu stricto as a target for serodiagnosis of early lyme disease.

    ID: 1975910

    Description: epitope description:EIETLLASIDELATK antigen name:Other Borreliella burgdorferi (Lyme disease spirochete) protein host organism:Homo sapiens

    Publication: 23365204;

  29. Outer surface protein C peptide derived from Borrelia burgdorferi sensu stricto as a target for serodiagnosis of early lyme disease.

    ID: 1975911

    Description: epitope description:LASIDELATKAIGKK antigen name:Other Borreliella burgdorferi (Lyme disease spirochete) protein host organism:Homo sapiens

    Publication: 23365204;

  30. Outer surface protein C peptide derived from Borrelia burgdorferi sensu stricto as a target for serodiagnosis of early lyme disease.

    ID: 1975912

    Description: epitope description:ELATKAIGKKIQQNG antigen name:Other Borreliella burgdorferi (Lyme disease spirochete) protein host organism:Homo sapiens

    Publication: 23365204;

  31. Outer surface protein C peptide derived from Borrelia burgdorferi sensu stricto as a target for serodiagnosis of early lyme disease.

    ID: 1975914

    Description: epitope description:IQQNGGLAVEAGHNG antigen name:Other Borreliella burgdorferi (Lyme disease spirochete) protein host organism:Homo sapiens

    Publication: 23365204;

  32. Outer surface protein C peptide derived from Borrelia burgdorferi sensu stricto as a target for serodiagnosis of early lyme disease.

    ID: 1975915

    Description: epitope description:GLAVEAGHNGTLLAG antigen name:Other Borreliella burgdorferi (Lyme disease spirochete) protein host organism:Homo sapiens

    Publication: 23365204;

  33. Outer surface protein C peptide derived from Borrelia burgdorferi sensu stricto as a target for serodiagnosis of early lyme disease.

    ID: 1975932

    Description: epitope description:AAELEKLFKAVENLA antigen name:Other Borreliella burgdorferi (Lyme disease spirochete) protein host organism:Homo sapiens

    Publication: 23365204;

  34. Outer surface protein C peptide derived from Borrelia burgdorferi sensu stricto as a target for serodiagnosis of early lyme disease.

    ID: 1975933

    Description: epitope description:KLFKAVENLAKAAKE antigen name:Other Borreliella burgdorferi (Lyme disease spirochete) protein host organism:Homo sapiens

    Publication: 23365204;

  35. Outer surface protein C peptide derived from Borrelia burgdorferi sensu stricto as a target for serodiagnosis of early lyme disease.

    ID: 1975936

    Description: epitope description:EMLANSVKELTSPIV antigen name:Other Borreliella burgdorferi (Lyme disease spirochete) protein host organism:Homo sapiens

    Publication: 23365204;

  36. Outer surface protein C peptide derived from Borrelia burgdorferi sensu stricto as a target for serodiagnosis of early lyme disease.

    ID: 1975938

    Description: epitope description:TLLAGAYTISKLITQ antigen name:Other Borreliella burgdorferi (Lyme disease spirochete) protein host organism:Homo sapiens

    Publication: 23365204;

  37. Outer surface protein C peptide derived from Borrelia burgdorferi sensu stricto as a target for serodiagnosis of early lyme disease.

    ID: 1975939

    Description: epitope description:AKKAILITDAAKDKG antigen name:Other Borreliella burgdorferi (Lyme disease spirochete) protein host organism:Homo sapiens

    Publication: 23365204;

  38. Outer surface protein C peptide derived from Borrelia burgdorferi sensu stricto as a target for serodiagnosis of early lyme disease.

    ID: 1975941

    Description: epitope description:PVVAESPKKP antigen name:UniProt:C0R9U8 host organism:Homo sapiens

    Publication: 23365204;

  39. Impact of antibodies against amyloidogenic transthyretin (ATTR) on phenotypes of patients with familial amyloidotic polyneuropathy (FAP) ATTR Valine30...

    ID: 1975946

    Description: epitope description:PAINVAMHVFRK antigen name:Transthyretin host organism:Homo sapiens

    Publication: 23462670;

  40. Missing the target: characterization of bullous pemphigoid patients who are negative using the BP180 enzyme-linked immunosorbant assay.

    ID: 1975972

    Description: epitope description:RLLSTDASHSRGSSSSSHSSSVRRGSSYSSSMSTGG antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

    Publication: 23083837;

  41. Design of synthetic autonomous VH domain libraries and structural analysis of a VH domain bound to vascular endothelial growth factor.

    ID: 1975977

    Description: epitope description:H38, Y65, D67, F73, P96, T97, E98, E99, S100, N101, T103, Q105, I106, M107, R108, H116, I117, G118, E119, M120, S121, L123, N126, ...

    Publication: 23507309;

  42. Design of synthetic autonomous VH domain libraries and structural analysis of a VH domain bound to vascular endothelial growth factor.

    ID: 1975979

    Description: epitope description:H38, Y65, D67, F73, P96, T97, E98, E99, S100, N101, T103, Q105, I106, M107, R108, H116, I117, G118, E119, M120, S121, L123, N126, ...

    Publication: 23507309;

  43. Characterization of a single-chain variable fragment recognizing a linear epitope of abeta: a biotechnical tool for studies on Alzheimer's disease?

    ID: 1975983

    Description: epitope description:DAEFRHDS antigen name:Amyloid beta A4 protein host organism:Mus musculus PrP null antibody name:IC16

    Publication: 23555792;

  44. Domain-swapped chain connectivity and gated membrane access in a Fab-mediated crystal of the human TRAAK K+ channel.

    ID: 1975987

    Description: epitope description:A: R43, E44, L47, R48, H50, P51, C52, V53, S54, D55, Q56, E57; B: A49, H50, P51, N78 antigen name:Potassium channel subfamily K me...

    Publication: 23341632;

  45. Identification of conserved neutralizing linear epitopes within the VP1 protein of coxsackievirus A16.

    ID: 1976012

    Description: epitope description:TAANTEASSHRLGTG antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 23499595;

  46. Identification of conserved neutralizing linear epitopes within the VP1 protein of coxsackievirus A16.

    ID: 1976018

    Description: epitope description:ALQAAETGASSNASD antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 23499595;

  47. Identification of conserved neutralizing linear epitopes within the VP1 protein of coxsackievirus A16.

    ID: 1976022

    Description: epitope description:ASDKNLIETRCVLNH antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 23499595;

  48. Identification of conserved neutralizing linear epitopes within the VP1 protein of coxsackievirus A16.

    ID: 1976033

    Description: epitope description:SIITMPTTGTQNTDG antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 23499595;

  49. Identification of conserved neutralizing linear epitopes within the VP1 protein of coxsackievirus A16.

    ID: 1976043

    Description: epitope description:RKCELFTYMRFDAEF antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 23499595;

  50. Identification of conserved neutralizing linear epitopes within the VP1 protein of coxsackievirus A16.

    ID: 1976048

    Description: epitope description:TFVVAKPNGELVPQL antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 23499595;

  51. Identification of conserved neutralizing linear epitopes within the VP1 protein of coxsackievirus A16.

    ID: 1976051

    Description: epitope description:ELVPQLLQYMYVPPG antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 23499595;

  52. Identification of conserved neutralizing linear epitopes within the VP1 protein of coxsackievirus A16.

    ID: 1976057

    Description: epitope description:PTSRDSFAWQTATNP antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 23499595;

  53. Identification of conserved neutralizing linear epitopes within the VP1 protein of coxsackievirus A16.

    ID: 1976074

    Description: epitope description:HLQANDLDYGQCPNN antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 23499595;

  54. Identification of conserved neutralizing linear epitopes within the VP1 protein of coxsackievirus A16.

    ID: 1976078

    Description: epitope description:PNNMMGTFSIRTVGT antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 23499595;

  55. Identification of conserved neutralizing linear epitopes within the VP1 protein of coxsackievirus A16.

    ID: 1976080

    Description: epitope description:TFSIRTVGTEKSPHS antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 23499595;

  56. Identification of conserved neutralizing linear epitopes within the VP1 protein of coxsackievirus A16.

    ID: 1976089

    Description: epitope description:RAWIPRPLRNQPYLF antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 23499595;

  57. Identification of conserved neutralizing linear epitopes within the VP1 protein of coxsackievirus A16.

    ID: 1976090

    Description: epitope description:IPRPLRNQPYLFKTN antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 23499595;

  58. Identification of conserved neutralizing linear epitopes within the VP1 protein of coxsackievirus A16.

    ID: 1976097

    Description: epitope description:DIKCTSTSRDKITTL antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 23499595;

  59. Identification of conserved neutralizing linear epitopes within the VP1 protein of coxsackievirus A16.

    ID: 1976098

    Description: epitope description:SRAGLVSIITMPTTG antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 23499595;

  60. Identification of conserved neutralizing linear epitopes within the VP1 protein of coxsackievirus A16.

    ID: 1976110

    Description: epitope description:RAWIPRPLRNQPYLF antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 23499595;

  61. Identification of conserved neutralizing linear epitopes within the VP1 protein of coxsackievirus A16.

    ID: 1976112

    Description: epitope description:YLFKTNPNYKGNDIK antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 23499595;

  62. Identification of conserved neutralizing linear epitopes within the VP1 protein of coxsackievirus A16.

    ID: 1976114

    Description: epitope description:TMPTMGTQNTDGYAN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 23499595;

  63. Identification of conserved neutralizing linear epitopes within the VP1 protein of coxsackievirus A16.

    ID: 1976118

    Description: epitope description:WDIDLMGYAQLRRKC antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 23499595;

  64. Identification of conserved neutralizing linear epitopes within the VP1 protein of coxsackievirus A16.

    ID: 1976123

    Description: epitope description:PTSRDSFAWQTATNP antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 23499595;

  65. Identification of conserved neutralizing linear epitopes within the VP1 protein of coxsackievirus A16.

    ID: 1976129

    Description: epitope description:PAQVSVPFMSPASAY antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 23499595;

  66. Identification of conserved neutralizing linear epitopes within the VP1 protein of coxsackievirus A16.

    ID: 1976135

    Description: epitope description:YLFKTNPNYKGNDIK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 23499595;

  67. Glycan shifting on hepatitis C virus (HCV) E2 glycoprotein is a mechanism for escape from broadly neutralizing antibodies.

    ID: 1976155

    Description: epitope description:QLINTNGSWHIN antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:hu5B3.v3

    Publication: 23458406;

  68. Glycan shifting on hepatitis C virus (HCV) E2 glycoprotein is a mechanism for escape from broadly neutralizing antibodies.

    ID: 1976156

    Description: epitope description:QLINTNGSWHIN antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:MRCT10.v362

    Publication: 23458406;

  69. Plasmodium falciparum synthetic LbL microparticle vaccine elicits protective neutralizing antibody and parasite-specific cellular immune responses.

    ID: 1976168

    Description: epitope description:NANPNANPNANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus C57BL/6

    Publication: 23481177;

  70. Glycan shifting on hepatitis C virus (HCV) E2 glycoprotein is a mechanism for escape from broadly neutralizing antibodies.

    ID: 1976175

    Description: epitope description:QLINTNGSWHIN antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:hu5B3.v3

    Publication: 23458406;

  71. Glycan shifting on hepatitis C virus (HCV) E2 glycoprotein is a mechanism for escape from broadly neutralizing antibodies.

    ID: 1976179

    Description: epitope description:QLINTNGSWHIN antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:hu5B3.v3

    Publication: 23458406;

  72. Glycan shifting on hepatitis C virus (HCV) E2 glycoprotein is a mechanism for escape from broadly neutralizing antibodies.

    ID: 1976184

    Description: epitope description:QLINTNGSWHIN antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:hu5B3.v3

    Publication: 23458406;

  73. Isolation of recombinant phage antibodies targeting the hemagglutinin cleavage site of highly pathogenic avian influenza virus.

    ID: 1976186

    Description: epitope description:NSPQRER antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:A4

    Publication: 23577205;

  74. Isolation of recombinant phage antibodies targeting the hemagglutinin cleavage site of highly pathogenic avian influenza virus.

    ID: 1976187

    Description: epitope description:NSPQRER antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:D4

    Publication: 23577205;

  75. Isolation of recombinant phage antibodies targeting the hemagglutinin cleavage site of highly pathogenic avian influenza virus.

    ID: 1976194

    Description: epitope description:NSPQRER antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:A4

    Publication: 23577205;

  76. Isolation of recombinant phage antibodies targeting the hemagglutinin cleavage site of highly pathogenic avian influenza virus.

    ID: 1976201

    Description: epitope description:NSPQRER antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:A3

    Publication: 23577205;

  77. Isolation of recombinant phage antibodies targeting the hemagglutinin cleavage site of highly pathogenic avian influenza virus.

    ID: 1976203

    Description: epitope description:NSPQRER antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:D4

    Publication: 23577205;

  78. Isolation of recombinant phage antibodies targeting the hemagglutinin cleavage site of highly pathogenic avian influenza virus.

    ID: 1976205

    Description: epitope description:NSPQRER antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:A3

    Publication: 23577205;

  79. Monoclonal anti-citrullinated protein antibodies selected on citrullinated fibrinogen have distinct targets with different cross-reactivity patterns.

    ID: 1976211

    Description: epitope description:RPAPPPISGGGYRAR + CITR(R1, R13, R15) antigen name:Fibrinogen beta chain host organism:Homo sapiens antibody name:cFib1.2

    Publication: 23264551;

  80. A novel B cell epitope in cold-shock DEAD-box protein A from Mycobacterium tuberculosis.

    ID: 1976212

    Description: epitope description:APDPPLSRR antigen name:ATP-dependent RNA helicase DeaD host organism:Mus musculus BALB/c antibody name:A3G5

    Publication: 23261158;

  81. A novel B cell epitope in cold-shock DEAD-box protein A from Mycobacterium tuberculosis.

    ID: 1976220

    Description: epitope description:YGNAPDKPLSKR host organism:Mus musculus BALB/c antibody name:A3G5

    Publication: 23261158;

  82. A novel B cell epitope in cold-shock DEAD-box protein A from Mycobacterium tuberculosis.

    ID: 1976222

    Description: epitope description:YGNAPDKPLSKR host organism:Mus musculus BALB/c

    Publication: 23261158;

  83. A novel B cell epitope in cold-shock DEAD-box protein A from Mycobacterium tuberculosis.

    ID: 1976227

    Description: epitope description:TERAPDSPTSKS host organism:Mus musculus BALB/c antibody name:A3G5

    Publication: 23261158;

  84. A novel B cell epitope in cold-shock DEAD-box protein A from Mycobacterium tuberculosis.

    ID: 1976228

    Description: epitope description:TERAPDSPTSKS host organism:Mus musculus BALB/c

    Publication: 23261158;

  85. A novel B cell epitope in cold-shock DEAD-box protein A from Mycobacterium tuberculosis.

    ID: 1976235

    Description: epitope description:TERPPDSPASKS host organism:Mus musculus BALB/c antibody name:A3G5

    Publication: 23261158;

  86. A novel B cell epitope in cold-shock DEAD-box protein A from Mycobacterium tuberculosis.

    ID: 1976237

    Description: epitope description:STSPDFPLSSFY host organism:Mus musculus BALB/c antibody name:A3G5

    Publication: 23261158;

  87. A novel B cell epitope in cold-shock DEAD-box protein A from Mycobacterium tuberculosis.

    ID: 1976243

    Description: epitope description:HSHHTLTPDPPL host organism:Mus musculus BALB/c antibody name:A3G5

    Publication: 23261158;

  88. A novel B cell epitope in cold-shock DEAD-box protein A from Mycobacterium tuberculosis.

    ID: 1976245

    Description: epitope description:YAPTPPLSRIDP host organism:Mus musculus BALB/c antibody name:A3G5

    Publication: 23261158;

  89. A novel B cell epitope in cold-shock DEAD-box protein A from Mycobacterium tuberculosis.

    ID: 1976246

    Description: epitope description:YAPTPPLSRIDP host organism:Mus musculus BALB/c antibody name:A3G5

    Publication: 23261158;

  90. Identification of a major immunogenic region of equine herpesvirus-1 glycoprotein E and its application to enzyme-linked immunosorbent assay.

    ID: 1976257

    Description: epitope description:MKNNPVYSESL antigen name:70 host organism:Equus caballus

    Publication: 23434015;

  91. Rational HIV immunogen design to target specific germline B cell receptors.

    ID: 1976273

    Description: epitope description:T455, R456, D457, G458, G459, S461, N462, E466, I467, R469, G472, G473, D474, R476, D477, V275, D279, N280, A281, K282, S365, G366...

    Publication: 23539181;

  92. Atomic structure of a nanobody-trapped domain-swapped dimer of an amyloidogenic beta2-microglobulin variant.

    ID: 1976386

    Description: epitope description:D: L40, K41, N42, G43, E44, R45, E47, K75, D76, E77, R81; E: I92, K94 antigen name:Beta-2-microglobulin host organism:Camelus drom...

    Publication: 21220305;

  93. Novel mutations in Marburg virus glycoprotein associated with viral evasion from antibody mediated immune pressure.

    ID: 1976396

    Description: epitope description:NKYSTSPSPTPNSTAQHLVY antigen name:Envelope glycoprotein host organism:Mus musculus BALB/c antibody name:APH159-1-3, MGP72-17

    Publication: 23288419;

  94. Novel mutations in Marburg virus glycoprotein associated with viral evasion from antibody mediated immune pressure.

    ID: 1976397

    Description: epitope description:NKYSTSPSPTPNSTAQHLVY antigen name:Envelope glycoprotein host organism:Mus musculus BALB/c antibody name:APH159-1-3, MGP72-17

    Publication: 23288419;

  95. Identification of a major immunogenic region of equine herpesvirus-1 glycoprotein E and its application to enzyme-linked immunosorbent assay.

    ID: 1976413

    Description: epitope description:KTPPPVTVPQVPVKTHTDFV antigen name:Envelope glycoprotein E host organism:Equus caballus

    Publication: 23434015;

  96. Identification and characterization of antigenic epitope of Staphylococcus aureus ClfA adhesin.

    ID: 1976416

    Description: epitope description:SKVGIDKRRGTA host organism:Mus musculus BALB/c

    Publication: 23178048;

  97. Identification and characterization of antigenic epitope of Staphylococcus aureus ClfA adhesin.

    ID: 1976423

    Description: epitope description:FSRGTHWKAPDP host organism:Mus musculus BALB/c antibody name:D01

    Publication: 23178048;

  98. Identification and characterization of antigenic epitope of Staphylococcus aureus ClfA adhesin.

    ID: 1976425

    Description: epitope description:WHATKQPYSKIR host organism:Mus musculus BALB/c antibody name:D01

    Publication: 23178048;

  99. Impact of antibodies against amyloidogenic transthyretin (ATTR) on phenotypes of patients with familial amyloidotic polyneuropathy (FAP) ATTR Valine30...

    ID: 1976470

    Description: epitope description:LMVKVLDAVRGS antigen name:Transthyretin host organism:Homo sapiens

    Publication: 23462670;

  100. Impact of antibodies against amyloidogenic transthyretin (ATTR) on phenotypes of patients with familial amyloidotic polyneuropathy (FAP) ATTR Valine30...

    ID: 1976478

    Description: epitope description:YTIAALLSPYS antigen name:Transthyretin host organism:Homo sapiens

    Publication: 23462670;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston