Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512121

    Description: epitope description:NGVWVMMDGNEQVEYPLK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  2. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512122

    Description: epitope description:NGVWVMMDGNEQVEYPLK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  3. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512125

    Description: epitope description:NGVWVMMDGNEQVEYPLK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  4. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512127

    Description: epitope description:DGEEQVEYPLKPI antigen name:polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  5. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512131

    Description: epitope description:EQVEYPLKPI antigen name:polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  6. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512139

    Description: epitope description:FDFYEVTSRTPVRAREA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  7. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512140

    Description: epitope description:FDFYEVTSRTPVRAREA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  8. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512155

    Description: epitope description:MNYTGNQQSRWGLGSPNCHGPDWASPVCQRHS antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;

  9. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512159

    Description: epitope description:MNYTGNQQSRWGLGSPNCHGPDWASPVCQRHS antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;

  10. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512164

    Description: epitope description:DLVEYIMNYTGNQQSRWGLGSPNC antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;

  11. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512165

    Description: epitope description:MNYTGNQQSRWGLGSPNCHGPDWASPVCQRHS antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;

  12. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512169

    Description: epitope description:MNYTGNQQSRWGLGSPNCHGPDWASPVCQRHS antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;

  13. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512170

    Description: epitope description:DLVEYIMNYTGNQQSRWGLGSPNC antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;

  14. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512174

    Description: epitope description:HGPDWASPVCQRHSPDCSRLVG antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;

  15. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512201

    Description: epitope description:ASSPDAHVPFCFGKDLKRPGSSPME antigen name:Pertussis toxin subunit 4 host organism:Mus musculus C57BL/6

    Publication: 7684728;

  16. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512217

    Description: epitope description:QLTFEGKPALELIRMVECSGKQDCP antigen name:Pertussis toxin subunit 4 host organism:Mus musculus C57BL/6

    Publication: 7684728;

  17. Pathotyping isolates of Newcastle disease virus using antipeptide antibodies to pathotype-specific regions of their fusion and hemagglutinin-neuramini...

    ID: 1512219

    Description: epitope description:VTTSGGGRQG antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 10076509;

  18. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512234

    Description: epitope description:FLGPKQLTFEGKPALELIRMVECSG antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  19. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512238

    Description: epitope description:MVVTSVAMKPYEVTPTRMLVCGIAA antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  20. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512251

    Description: epitope description:AASSPDA antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston