Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Structural characterisation of sporozoite components for a multistage, multi-epitope, anti-malarial vaccine.

    ID: 1476591

    Description: epitope description:GASADYGGEPAPRPEAHGEE host organism:Aotus antibody name:Monkey sera

    Publication: 17997122;

  2. Evaluation of immunoglobulin G4 subclass antibody in a peptide-based enzyme-linked immunosorbent assay for the serodiagnosis of human fascioliasis.

    ID: 1476594

    Description: epitope description:DKIDWRESGYVTEVKDQGNC antigen name:Cathepsin L (UniProt:Q9NGW4) host organism:Homo sapiens

    Publication: 17714604;

  3. Induction of epitope-specific neutralizing antibodies against West Nile virus.

    ID: 1476604

    Description: epitope description:W101 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6

    Publication: 17715236;

  4. Induction of epitope-specific neutralizing antibodies against West Nile virus.

    ID: 1476607

    Description: epitope description:W101 antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 17715236;

  5. Induction of epitope-specific neutralizing antibodies against West Nile virus.

    ID: 1476610

    Description: epitope description:K307 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:CR4374

    Publication: 17715236;

  6. Identification of pentadecapeptide mimicking muramyl peptide.

    ID: 1476647

    Description: epitope description:RVPPRYHAKISPMVN host organism:Mus musculus antibody name:E6/1.2

    Publication: 17005302;

  7. Identification of pentadecapeptide mimicking muramyl peptide.

    ID: 1476648

    Description: epitope description:RVPPRYHAKISPMVN host organism:Mus musculus antibody name:E6/1.2

    Publication: 17005302;

  8. Immunodominant epitopes mapped by synthetic peptides on the capsid protein of avian hepatitis E virus are non-protective.

    ID: 1476684

    Description: epitope description:GNQHVDDRPSPAPAPKRALGTL antigen name:Capsid protein host organism:Gallus gallus

    Publication: 18355123;

  9. Immunodominant epitopes mapped by synthetic peptides on the capsid protein of avian hepatitis E virus are non-protective.

    ID: 1476704

    Description: epitope description:APEDQSPETRRLLDRLSR antigen name:Capsid protein host organism:Gallus gallus

    Publication: 18355123;

  10. Antibodies to a nonconjugated prion protein peptide 95-123 interfere with PrP( Sc ) propagation in prion-infected cells.

    ID: 1476730

    Description: epitope description:FVHDCVNITVKEHTVTT antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Rabbit Serum

    Publication: 17205391;

  11. Antibodies to a nonconjugated prion protein peptide 95-123 interfere with PrP( Sc ) propagation in prion-infected cells.

    ID: 1476732

    Description: epitope description:FVHDCVNITVKEHTVTT antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Rabbit Serum

    Publication: 17205391;

  12. Antibodies to a nonconjugated prion protein peptide 95-123 interfere with PrP( Sc ) propagation in prion-infected cells.

    ID: 1476734

    Description: epitope description:IKMMERVVEQMCITQYQRESQAYYQRG antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Rabbit Serum

    Publication: 17205391;

  13. Antibodies to a nonconjugated prion protein peptide 95-123 interfere with PrP( Sc ) propagation in prion-infected cells.

    ID: 1476738

    Description: epitope description:MCITQYQRESQAYYQRG antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Rabbit Serum

    Publication: 17205391;

  14. Expression and immunogenicity of pertussis toxin S1 subunit-tetanus toxin fragment C fusions in Salmonella typhi vaccine strain CVD 908.

    ID: 1476747

    Description: epitope description:VYRYDSRP antigen name:Pertussis toxin subunit 1 host organism:Mus musculus BALB/c antibody name:3CX4

    Publication: 8926085;

  15. The fourth surface-exposed region of the outer membrane protein P5-homologous adhesin of nontypable Haemophilus influenzae is an immunodominant but no...

    ID: 1476779

    Description: epitope description:SFHDGINNNGAIKKGLSSSNYGYRRNTF antigen name:Outer membrane protein A (3aII*Gd) host organism:Homo sapiens antibody name:Human patien...

    Publication: 12902501;

  16. The fourth surface-exposed region of the outer membrane protein P5-homologous adhesin of nontypable Haemophilus influenzae is an immunodominant but no...

    ID: 1476785

    Description: epitope description:LVRSDYKFYEDANGTRDHKKGRHT antigen name:Outer membrane protein A (3aII*Gd) host organism:Chinchilla lanigera antibody name:Chinchill...

    Publication: 12902501;

  17. The fourth surface-exposed region of the outer membrane protein P5-homologous adhesin of nontypable Haemophilus influenzae is an immunodominant but no...

    ID: 1476786

    Description: epitope description:TRVGKYRPQDKPNTAINYNPWIG antigen name:Outer membrane protein A (3aII*Gd) host organism:Chinchilla lanigera antibody name:Convalesce...

    Publication: 12902501;

  18. Selection of mimotopes of Bovine Viral Diarrhoea Virus using a solid-phase peptide library.

    ID: 1476824

    Description: epitope description:LHEQYYYF host organism:Mus musculus antibody name:157

    Publication: 17825961;

  19. Topological mapping of the P1-adhesin of Mycoplasma pneumoniae with adherence-inhibiting monoclonal antibodies.

    ID: 1476849

    Description: epitope description:NAINPRLTPWTYRN antigen name:Adhesin P1 host organism:Mus musculus BALB/c antibody name:aN

    Publication: 1697324;

  20. Topological mapping of the P1-adhesin of Mycoplasma pneumoniae with adherence-inhibiting monoclonal antibodies.

    ID: 1476878

    Description: epitope description:NALSFTNK antigen name:Adhesin P1 host organism:Mus musculus BALB/c antibody name:P1.26

    Publication: 1697324;

  21. Topological mapping of the P1-adhesin of Mycoplasma pneumoniae with adherence-inhibiting monoclonal antibodies.

    ID: 1476880

    Description: epitope description:DVVGVGRL antigen name:Adhesin P1 host organism:Mus musculus BALB/c antibody name:P1.26

    Publication: 1697324;

  22. Priming with SARS CoV S DNA and boosting with SARS CoV S epitopes specific for CD4+ and CD8+ T cells promote cellular immune responses.

    ID: 1476953

    Description: epitope description:NYNYKYRYLR antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 17709158;

  23. The amino acid sequence of the outer coat protein VP2 of neutralizing monoclonal antibody-resistant, virulent and attenuated bluetongue viruses.

    ID: 1476963

    Description: epitope description:S321 antigen name:Outer capsid protein VP2 host organism:Mus musculus BALB/c antibody name:31D8A1

    Publication: 1706548;

  24. Morphogenesis of a bluetongue virus variant with an amino acid alteration at a neutralization site in the outer coat protein, VP2.

    ID: 1476992

    Description: epitope description:E328, R330, R333, D335 antigen name:Outer capsid protein VP2 host organism:Mus musculus BALB/c antibody name:9J3/G6

    Publication: 2838961;

  25. Morphogenesis of a bluetongue virus variant with an amino acid alteration at a neutralization site in the outer coat protein, VP2.

    ID: 1476994

    Description: epitope description:E328, R330, R333, D335 antigen name:Outer capsid protein VP2 host organism:Mus musculus BALB/c antibody name:9J3/G6

    Publication: 2838961;

  26. Identification of a novel Fasciola hepatica cathepsin L protease containing protective epitopes within the propeptide.

    ID: 1476998

    Description: epitope description:GSNDDLWHQWKRMYNKEYN antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Rattus

    Publication: 15111089;

  27. Identification of a novel Fasciola hepatica cathepsin L protease containing protective epitopes within the propeptide.

    ID: 1477004

    Description: epitope description:NNRAVPDKIDWRESGYVTE antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Rattus

    Publication: 15111089;

  28. Identification of a novel Fasciola hepatica cathepsin L protease containing protective epitopes within the propeptide.

    ID: 1477010

    Description: epitope description:SNDVSWHEWKRMYNKEYNG antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Rattus

    Publication: 15111089;

  29. Identification of a novel Fasciola hepatica cathepsin L protease containing protective epitopes within the propeptide.

    ID: 1477012

    Description: epitope description:SNDVSWHEWKRMYNKEYNG antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Rattus

    Publication: 15111089;

  30. Monoclonal antibodies against the nucleocapsid proteins of henipaviruses: production, epitope mapping and application in immunohistochemistry.

    ID: 1477023

    Description: epitope description:RTTDFKREMSTS host organism:Mus musculus BALB/c antibody name:N4E2

    Publication: 17978885;

  31. Beta-PrP form of human prion protein stimulates production of monoclonal antibodies to epitope 91-110 that recognise native PrPSc.

    ID: 1477057

    Description: epitope description:SDYEDRYYREN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:ICSM18

    Publication: 17936697;

  32. Beta-PrP form of human prion protein stimulates production of monoclonal antibodies to epitope 91-110 that recognise native PrPSc.

    ID: 1477058

    Description: epitope description:SDYEDRYYREN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:ICSM18

    Publication: 17936697;

  33. Beta-PrP form of human prion protein stimulates production of monoclonal antibodies to epitope 91-110 that recognise native PrPSc.

    ID: 1477059

    Description: epitope description:SDYEDRYYREN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:ICSM18

    Publication: 17936697;

  34. The fourth surface-exposed region of the outer membrane protein P5-homologous adhesin of nontypable Haemophilus influenzae is an immunodominant but no...

    ID: 1477068

    Description: epitope description:RSDYKFYEDANGTRDHKKG antigen name:Outer membrane protein A (3aII*Gd) host organism:Chinchilla lanigera antibody name:Chinchilla ser...

    Publication: 12902501;

  35. Beta-PrP form of human prion protein stimulates production of monoclonal antibodies to epitope 91-110 that recognise native PrPSc.

    ID: 1477628

    Description: epitope description:GSAMSRPIIHFGSDYEDRYY antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:ICSM17

    Publication: 17936697;

  36. Beta-PrP form of human prion protein stimulates production of monoclonal antibodies to epitope 91-110 that recognise native PrPSc.

    ID: 1477633

    Description: epitope description:SRPIIHFGS antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:ICSM30, ICSM31, ICSM32

    Publication: 17936697;

  37. Beta-PrP form of human prion protein stimulates production of monoclonal antibodies to epitope 91-110 that recognise native PrPSc.

    ID: 1477635

    Description: epitope description:SRPIIHFGS antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:ICSM30, ICSM31, ICSM32

    Publication: 17936697;

  38. Identification and characterization of a neutralizing monoclonal antibody for the epitope on HM-1 killer toxin.

    ID: 1477681

    Description: epitope description:TGGSTDGKQG antigen name:Killer toxin HM-1 host organism:Mus musculus BALB/c antibody name:nmAb-KT

    Publication: 16567405;

  39. Identification and characterization of a neutralizing monoclonal antibody for the epitope on HM-1 killer toxin.

    ID: 1477709

    Description: epitope description:TGGSTDGKQG antigen name:Killer toxin HM-1 host organism:Mus musculus BALB/c antibody name:nmAb-KT

    Publication: 16567405;

  40. Antigenic structure of the human respiratory syncytial virus G glycoprotein and relevance of hypermutation events for the generation of antigenic vari...

    ID: 1477804

    Description: epitope description:Q142, K145 antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:021/5G

    Publication: 9349460;

  41. The GPRLQPY motif located at the carboxy-terminal of the spike protein induces antibodies that neutralize Porcine epidemic diarrhea virus.

    ID: 1477813

    Description: epitope description:GPRLQPY antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 18067984;

  42. Determination of the human antibody response to the epitope defined by the hepatitis C virus-neutralizing monoclonal antibody AP33.

    ID: 1477815

    Description: epitope description:QLINTNGSWHIN antigen name:Genome polyprotein host organism:Rattus norvegicus antibody name:3/11

    Publication: 17947521;

  43. Determination of the human antibody response to the epitope defined by the hepatitis C virus-neutralizing monoclonal antibody AP33.

    ID: 1477824

    Description: epitope description:QLINTNGSWHIN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 17947521;

  44. Type- and subcomplex-specific neutralizing antibodies against domain III of dengue virus type 2 envelope protein recognize adjacent epitopes.

    ID: 1477830

    Description: epitope description:G304, E383, P384 antigen name:Genome polyprotein host organism:Mus musculus antibody name:3H5-1, M8051122, 9F16, 9F11, 2Q1899

    Publication: 17881453;

  45. Type- and subcomplex-specific neutralizing antibodies against domain III of dengue virus type 2 envelope protein recognize adjacent epitopes.

    ID: 1477834

    Description: epitope description:G304, D329, G330, S331, E383, P384 antigen name:Genome polyprotein host organism:Mus musculus antibody name:6B6-10

    Publication: 17881453;

  46. Determination of the human antibody response to the epitope defined by the hepatitis C virus-neutralizing monoclonal antibody AP33.

    ID: 1477851

    Description: epitope description:QLVNTNGSWHIN antigen name:Genome polyprotein host organism:Mus musculus antibody name:AP33

    Publication: 17947521;

  47. Determination of the human antibody response to the epitope defined by the hepatitis C virus-neutralizing monoclonal antibody AP33.

    ID: 1477853

    Description: epitope description:QLVNTNGSWHIN antigen name:Genome polyprotein host organism:Rattus norvegicus antibody name:3/11

    Publication: 17947521;

  48. Validation of synthetic peptide enzyme immunoassays in differentiating two subgroups of ruminant respiratory syncytial virus.

    ID: 1477861

    Description: epitope description:VPCSTCEGNLACLSLCQ antigen name:Major surface glycoprotein G host organism:Bos taurus

    Publication: 11289207;

  49. Determination of the human antibody response to the epitope defined by the hepatitis C virus-neutralizing monoclonal antibody AP33.

    ID: 1477871

    Description: epitope description:SLINTNGSWHIN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 17947521;

  50. Determination of the human antibody response to the epitope defined by the hepatitis C virus-neutralizing monoclonal antibody AP33.

    ID: 1477874

    Description: epitope description:QLVNSNGSWHIN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 17947521;

  51. Determination of the human antibody response to the epitope defined by the hepatitis C virus-neutralizing monoclonal antibody AP33.

    ID: 1477876

    Description: epitope description:QLVNSNGSWHIN antigen name:Genome polyprotein host organism:Rattus norvegicus antibody name:3/11

    Publication: 17947521;

  52. Validation of synthetic peptide enzyme immunoassays in differentiating two subgroups of ruminant respiratory syncytial virus.

    ID: 1477890

    Description: epitope description:VPCSTCEGNLACLSLCQ antigen name:Major surface glycoprotein G host organism:Ovis aries

    Publication: 11289207;

  53. Localization of antigenic sites of the S glycoprotein of feline infectious peritonitis virus involved in neutralization and antibody-dependent enhance...

    ID: 1477897

    Description: epitope description:D568, R656 antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:18A7.4

    Publication: 7707508;

  54. Localization of antigenic sites of the S glycoprotein of feline infectious peritonitis virus involved in neutralization and antibody-dependent enhance...

    ID: 1477899

    Description: epitope description:D643 antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:24H5.4

    Publication: 7707508;

  55. Type- and subcomplex-specific neutralizing antibodies against domain III of dengue virus type 2 envelope protein recognize adjacent epitopes.

    ID: 1477902

    Description: epitope description:G304, K305, K307, K310 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1A1D-2

    Publication: 17881453;

  56. Type- and subcomplex-specific neutralizing antibodies against domain III of dengue virus type 2 envelope protein recognize adjacent epitopes.

    ID: 1477904

    Description: epitope description:G304, K305, K307, K310 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1A1D-2

    Publication: 17881453;

  57. Type- and subcomplex-specific neutralizing antibodies against domain III of dengue virus type 2 envelope protein recognize adjacent epitopes.

    ID: 1477907

    Description: epitope description:H317 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5A2-7, WN E111

    Publication: 17881453;

  58. Type- and subcomplex-specific neutralizing antibodies against domain III of dengue virus type 2 envelope protein recognize adjacent epitopes.

    ID: 1477909

    Description: epitope description:H317 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5A2-7, WN E111

    Publication: 17881453;

  59. Type- and subcomplex-specific neutralizing antibodies against domain III of dengue virus type 2 envelope protein recognize adjacent epitopes.

    ID: 1477915

    Description: epitope description:H317,T359 antigen name:Genome polyprotein host organism:Mus musculus antibody name:13D4-1

    Publication: 17881453;

  60. Type- and subcomplex-specific neutralizing antibodies against domain III of dengue virus type 2 envelope protein recognize adjacent epitopes.

    ID: 1477922

    Description: epitope description:G304, K310 antigen name:Genome polyprotein host organism:Mus musculus antibody name:WN E114

    Publication: 17881453;

  61. Identification of two neutralization epitopes on the capsid protein of avian hepatitis E virus.

    ID: 1477963

    Description: epitope description:TVDASSGSNRFAALPAFGKPAVWGPQGAGYFYQYNSTH antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:5G10

    Publication: 18198381;

  62. Identification of two neutralization epitopes on the capsid protein of avian hepatitis E virus.

    ID: 1477967

    Description: epitope description:HQEWIYFLQNGSSVVWYAYTNMLGQKSDTSILFEVRPIQASDQPWFLAHHTGGDDCTT antigen name:Capsid protein host organism:Mus musculus BALB/c antibody ...

    Publication: 18198381;

  63. Identification of two neutralization epitopes on the capsid protein of avian hepatitis E virus.

    ID: 1477968

    Description: epitope description:HQEWIYFLQNGSSVVWYAYTNMLGQKSDTSILFEVRPIQASDQPWFLAHHTGGDDCTT antigen name:Capsid protein host organism:Mus musculus BALB/c antibody ...

    Publication: 18198381;

  64. Identification of aleutian mink disease parvovirus capsid sequences mediating antibody-dependent enhancement of infection, virus neutralization, and i...

    ID: 1477983

    Description: epitope description:EQELNFPHEVLDDAA antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 11602751;

  65. Vaccines prepared from chimeras of foot-and-mouth disease virus (FMDV) induce neutralizing antibodies and protective immunity to multiple serotypes of...

    ID: 1477991

    Description: epitope description:T678, T681 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2PD11

    Publication: 7523697;

  66. A peptide construct containing B-cell and T-cell epitopes from the foot-and-mouth disease viral VP1 protein induces efficient antiviral protection.

    ID: 1482066

    Description: epitope description:KYSAGGMGRRGDLEPLAARVAAQL antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 10075164;

  67. Localization of T and B cell stimulating domains of the immunodominant 33-kDa protein of Onchocerca volvulus (Ov33).

    ID: 1482091

    Description: epitope description:QKYLSSTIQKQVD antigen name:Immunodominant antigen Ov33-3 host organism:Homo sapiens antibody name:Human sera

    Publication: 9325070;

  68. A peptide construct containing B-cell and T-cell epitopes from the foot-and-mouth disease viral VP1 protein induces efficient antiviral protection.

    ID: 1482110

    Description: epitope description:TTIHELLVRMKRAELYCPR antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 10075164;

  69. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482116

    Description: epitope description:LEQPVSNDLS antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  70. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482119

    Description: epitope description:DLYKSNHNNV antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  71. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482130

    Description: epitope description:DSESGGHITH antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  72. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482132

    Description: epitope description:KDNPHPKGSR antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  73. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482136

    Description: epitope description:EKPNLSSKRSE antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  74. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482137

    Description: epitope description:LEQPVSNDLS antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  75. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482138

    Description: epitope description:PYQGSGKGVS antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  76. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482141

    Description: epitope description:DSESGGHITH antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  77. Induction of anti foot and mouth disease virus T and B cell responses in cattle immunized with a peptide representing ten amino acids of VP1.

    ID: 1482145

    Description: epitope description:RYSRNAVPNV antigen name:Polyprotein host organism:Bos taurus Holstein-Friesian

    Publication: 9569465;

  78. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482153

    Description: epitope description:LEQPVSNDLS antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  79. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482157

    Description: epitope description:DSESGGHITH antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  80. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482158

    Description: epitope description:SCTVTREDGT antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  81. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482166

    Description: epitope description:DLYKSNHNNV antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  82. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482168

    Description: epitope description:SCTVTREDGT antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  83. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482170

    Description: epitope description:NPDREYDFRD antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  84. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482184

    Description: epitope description:SCTVTREDGT antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  85. Antigenic analysis of bean pod mottle virus using linear and cyclized synthetic peptides.

    ID: 1482195

    Description: epitope description:AFSVPQANARSSENAESSA antigen name:RNA2 polyprotein host organism:Oryctolagus cuniculus antibody name:anti-BPMV

    Publication: 7679572;

  86. Enhanced immunogenicity of a conformational epitope of human T-lymphotropic virus type 1 using a novel chimeric peptide.

    ID: 1482202

    Description: epitope description:FLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSKLLTLVQLTL antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zeala...

    Publication: 11137241;

  87. Enhanced immunogenicity of a conformational epitope of human T-lymphotropic virus type 1 using a novel chimeric peptide.

    ID: 1482203

    Description: epitope description:FLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSKLLTLVQLTL antigen name:Envelope glycoprotein gp62 host organism:Mus musculus ICR

    Publication: 11137241;

  88. Type-independent detection of foot-and-mouth disease virus by monoclonal antibodies that bind to amino-terminal residues of capsid protein VP2.

    ID: 1482213

    Description: epitope description:ETTLLEDRILTTRNG antigen name:Genome polyprotein host organism:Mus musculus antibody name:13A6

    Publication: 11226567;

  89. Type-independent detection of foot-and-mouth disease virus by monoclonal antibodies that bind to amino-terminal residues of capsid protein VP2.

    ID: 1482215

    Description: epitope description:DKKTEETTLLEDRIL antigen name:Genome polyprotein host organism:Mus musculus antibody name:13A6

    Publication: 11226567;

  90. Type-independent detection of foot-and-mouth disease virus by monoclonal antibodies that bind to amino-terminal residues of capsid protein VP2.

    ID: 1482221

    Description: epitope description:DKKTEETTLLEDRIL antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:15F7

    Publication: 11226567;

  91. Type-independent detection of foot-and-mouth disease virus by monoclonal antibodies that bind to amino-terminal residues of capsid protein VP2.

    ID: 1482222

    Description: epitope description:ETTLLEDRILTTRNG antigen name:Genome polyprotein host organism:Mus musculus antibody name:13A6

    Publication: 11226567;

  92. Location of a highly conserved neutralizing epitope in the F glycoprotein of human respiratory syncytial virus.

    ID: 1482232

    Description: epitope description:N262, N268 antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c antibody name:47F

    Publication: 1688629;

  93. Antigenic analysis of bean pod mottle virus using linear and cyclized synthetic peptides.

    ID: 1482234

    Description: epitope description:FDSSKQSF antigen name:RNA2 polyprotein host organism:Oryctolagus cuniculus antibody name:anti-A20-27

    Publication: 7679572;

  94. Antigenic analysis of bean pod mottle virus using linear and cyclized synthetic peptides.

    ID: 1482240

    Description: epitope description:SIRGRASSDIY antigen name:RNA2 polyprotein host organism:Oryctolagus cuniculus antibody name:anti-C95-105

    Publication: 7679572;

  95. Protection of guinea-pigs against foot-and-mouth disease virus by immunization with a PhoE-FMDV hybrid protein.

    ID: 1482242

    Description: epitope description:YKQKIIAPYKQKIIAPSRRGDLGSLAPRV host organism:Cavia porcellus Duncan-Hartley

    Publication: 2174595;

  96. Molecular basis for linkage of a continuous and discontinuous neutralization epitope on the structural polypeptide VP2 of poliovirus type 1.

    ID: 1482258

    Description: epitope description:H142, N165, N166, T168 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:27.108

    Publication: 1689392;

  97. Neutralizing epitopes of type O foot-and-mouth disease virus. II. Mapping three conformational sites with synthetic peptide reagents.

    ID: 1482269

    Description: epitope description:N143, L144, R145, G146, R200, H201, K202, Q203, K204, I205, V206, A207, P208, V209, K210, Q211, T212, L213 antigen name:Genome po...

    Publication: 2471812;

  98. Identification of serotype-specific and nonserotype-specific B-cell epitopes of coxsackie B virus using synthetic peptides.

    ID: 1482275

    Description: epitope description:IGRVADTVGTGPNNS antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7513917;

  99. Identification of serotype-specific and nonserotype-specific B-cell epitopes of coxsackie B virus using synthetic peptides.

    ID: 1482293

    Description: epitope description:SIPFLSIGNAYSNFY antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7513917;

  100. Identification of serotype-specific and nonserotype-specific B-cell epitopes of coxsackie B virus using synthetic peptides.

    ID: 1482296

    Description: epitope description:TLNNMGTLYARHVNA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7513917;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston