Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Identification of type-specific domains within glycoprotein G of herpes simplex virus type 2 (HSV-2) recognized by the majority of patients infected w...

    ID: 1463760

    Description: epitope description:PHGPADAPPGSPAPPPPEHR antigen name:Envelope glycoprotein G host organism:Homo sapiens antibody name:Human sera

    Publication: 10423148;

  2. Immunization of pigs to prevent disease in humans: construction and protective efficacy of a Salmonella enterica serovar Typhimurium live negative-mar...

    ID: 1463853

    Description: epitope description:FAGLKFADY antigen name:Outer membrane porin protein OmpD host organism:Sus scrofa German Landrace

    Publication: 17296750;

  3. Protection of BALB/c mice from respiratory syncytial virus infection by immunization with a synthetic peptide derived from the G glycoprotein.

    ID: 1463884

    Description: epitope description:KRIPNKKPGKKTTTKPTKK antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c

    Publication: 1720589;

  4. Identification of potential B cell epitope determinants by computer techniques, in hemagglutinin-neuraminidase from the porcine rubulavirus La Piedad ...

    ID: 1463901

    Description: epitope description:TTTCFRDTDTGK antigen name:attachment protein host organism:Sus scrofa antibody name:Pig sera

    Publication: 17603842;

  5. Identification of potential B cell epitope determinants by computer techniques, in hemagglutinin-neuraminidase from the porcine rubulavirus La Piedad ...

    ID: 1463924

    Description: epitope description:TTTCFRDTDTGK antigen name:attachment protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 17603842;

  6. Diagnosis and differentiation of HTLV-I and HTLV-II infection by enzyme immunoassays using synthetic peptides.

    ID: 1463958

    Description: epitope description:TSEPTQPPPTSPPLVHDSDLEHVLTPSTSWTTKILKF antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1941526;

  7. Identification of type-specific domains within glycoprotein G of herpes simplex virus type 2 (HSV-2) recognized by the majority of patients infected w...

    ID: 1420203

    Description: epitope description:PEKTPLPVSATAMAPSVDPS antigen name:Envelope glycoprotein G host organism:Mus musculus antibody name:F11

    Publication: 10423148;

  8. Identification of type-specific domains within glycoprotein G of herpes simplex virus type 2 (HSV-2) recognized by the majority of patients infected w...

    ID: 1420213

    Description: epitope description:RAMAGRCRLLLSIGS host organism:Mus musculus antibody name:F11

    Publication: 10423148;

  9. Identification of an epitope on the recombinant bovine PrP that is able to elicit a prominent immune response in wild-type mice.

    ID: 1420229

    Description: epitope description:DYEDRYYRE antigen name:Major prion protein host organism:Mus musculus antibody name:6H4

    Publication: 17884181;

  10. Identification of type-specific domains within glycoprotein G of herpes simplex virus type 2 (HSV-2) recognized by the majority of patients infected w...

    ID: 1420249

    Description: epitope description:PEHRGGPEEFEGAGDGEPPE antigen name:Envelope glycoprotein G host organism:Homo sapiens antibody name:Human sera

    Publication: 10423148;

  11. Identification of type-specific domains within glycoprotein G of herpes simplex virus type 2 (HSV-2) recognized by the majority of patients infected w...

    ID: 1420251

    Description: epitope description:GGPEEFEGAGDGEPPEDDDS antigen name:Envelope glycoprotein G host organism:Homo sapiens antibody name:Human sera

    Publication: 10423148;

  12. Identification of type-specific domains within glycoprotein G of herpes simplex virus type 2 (HSV-2) recognized by the majority of patients infected w...

    ID: 1420252

    Description: epitope description:PEEFEGAGDGEPPEDDDSAT antigen name:Envelope glycoprotein G host organism:Homo sapiens antibody name:Human sera

    Publication: 10423148;

  13. Role of conformational and linear epitopes in the achievement of tolerance in cow's milk allergy.

    ID: 1420336

    Description: epitope description:EEIVPNSVEQ antigen name:Bos d 9 host organism:Homo sapiens antibody name:patient sera

    Publication: 11678861;

  14. Role of conformational and linear epitopes in the achievement of tolerance in cow's milk allergy.

    ID: 1420337

    Description: epitope description:EEIVPNSVEQ antigen name:Bos d 9 host organism:Homo sapiens antibody name:patient sera

    Publication: 11678861;

  15. Role of conformational and linear epitopes in the achievement of tolerance in cow's milk allergy.

    ID: 1420338

    Description: epitope description:PSFSDIPNPI antigen name:Bos d 9 host organism:Homo sapiens antibody name:patient sera

    Publication: 11678861;

  16. Role of conformational and linear epitopes in the achievement of tolerance in cow's milk allergy.

    ID: 1420342

    Description: epitope description:QSKVLPVPQK antigen name:Bos d 11 host organism:Homo sapiens antibody name:patient sera

    Publication: 11678861;

  17. Role of conformational and linear epitopes in the achievement of tolerance in cow's milk allergy.

    ID: 1420343

    Description: epitope description:QSKVLPVPQK antigen name:Bos d 11 host organism:Homo sapiens antibody name:patient sera

    Publication: 11678861;

  18. Role of conformational and linear epitopes in the achievement of tolerance in cow's milk allergy.

    ID: 1420347

    Description: epitope description:YQEPVLGPVR antigen name:Bos d 11 host organism:Homo sapiens antibody name:patient sera

    Publication: 11678861;

  19. A pre-PEXEL histidine-rich protein II erythrocyte binding peptide as a new way for anti-malarial vaccine development.

    ID: 1420348

    Description: epitope description:NNSAFNNNLCSKNAKGLNLN antigen name:Histidine-rich protein III host organism:Aotus nancymaae

    Publication: 17588541;

  20. A pre-PEXEL histidine-rich protein II erythrocyte binding peptide as a new way for anti-malarial vaccine development.

    ID: 1420417

    Description: epitope description:NNSAFNNNLCSKNAKGGNLN host organism:Aotus nancymaae

    Publication: 17588541;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston