Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

ID: 1512255

Description: epitope description:VECSGKQDCP antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

Pathotyping isolates of Newcastle disease virus using antipeptide antibodies to pathotype-specific regions of their fusion and hemagglutinin-neuramini...

ID: 1512298

Description: epitope description:VTTSGGRRQ antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

Pathotyping isolates of Newcastle disease virus using antipeptide antibodies to pathotype-specific regions of their fusion and hemagglutinin-neuramini...

ID: 1512302

Description: epitope description:REARSGRLSQLRE antigen name:Hemagglutinin-neuraminidase host organism:Oryctolagus cuniculus

Mutational analysis of the virus and monoclonal antibody binding sites in MHVR, the cellular receptor of the murine coronavirus mouse hepatitis virus ...

ID: 1512305

Description: epitope description:L60, A61, L62, G63, A64, F65, A66, D76, K77 antigen name:Carcinoembryonic antigen-related cell adhesion molecule 1 host organism:M...

Defining antibody targets in Streptococcus oralis infection.

ID: 1512324

Description: epitope description:TMYPNRQPGSGWDSS antigen name:Cell wall surface anchor family protein host organism:Homo sapiens

Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

ID: 1512326

Description: epitope description:RGDL antigen name:Polyprotein host organism:Mus musculus antibody name:7FC12, 7AH1, 7JD1, 7CA11

Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

ID: 1512344

Description: epitope description:RGDL antigen name:Polyprotein host organism:Mus musculus antibody name:7JD1, 7CA11

Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

ID: 1512346

Description: epitope description:RGDL antigen name:Polyprotein host organism:Mus musculus antibody name:7JD1, 7CA11

Defining antibody targets in Streptococcus oralis infection.

ID: 1512355

Description: epitope description:YPTVV antigen name:Cell wall surface anchor family protein host organism:Homo sapiens

Defining antibody targets in Streptococcus oralis infection.

ID: 1512365

Description: epitope description:YPTVV antigen name:Cell wall surface anchor family protein host organism:Homo sapiens

Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

ID: 1512389

Description: epitope description:RGDLXRGDLXRGDL host organism:Cavia porcellus Duncan-Hartley

Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

ID: 1512390

Description: epitope description:ARGDLAXARGDLAXARGDLA host organism:Cavia porcellus Duncan-Hartley

Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

ID: 1512392

Description: epitope description:RGDLRGDLRGDL host organism:Cavia porcellus Duncan-Hartley

Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

ID: 1512393

Description: epitope description:RGDLRGDLRGDL host organism:Cavia porcellus Duncan-Hartley

Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

ID: 1512404

Description: epitope description:RGDLRGDLRGDL host organism:Oryctolagus cuniculus New Zealand White

Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

ID: 1512407

Description: epitope description:RGDLARGDLARGDL host organism:Oryctolagus cuniculus New Zealand White

Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

ID: 1512420

Description: epitope description:RGDLRGDLRGDL host organism:Oryctolagus cuniculus New Zealand White

Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

ID: 1512424

Description: epitope description:VARGDLAARGDLAARGDLA host organism:Oryctolagus cuniculus New Zealand White

Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

ID: 1512425

Description: epitope description:RGDLXRGDLXRGDL host organism:Cavia porcellus Duncan-Hartley

Structure-function analyses of diphtheria toxin by use of monoclonal antibodies.

ID: 1512451

Description: epitope description:GVHANLHVAFHRSSSEKIHSNEISSDSIGVLGYQKTVDHTKVNSKLSLFFEIKS antigen name:Diphtheria toxin (UniProt:H2GU79) host organism:Mus musculus B...