Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Unmasking the anti-La/SSB response in sera from patients with Sjogren's syndrome by specific blocking of anti-idiotypic antibodies to La/SSB antigenic...

    ID: 1692573

    Description: epitope description:NNGNLQLRNKEVTWEVLEG antigen name:Lupus La protein host organism:Homo sapiens

    Publication: 12428060;

  2. Unmasking the anti-La/SSB response in sera from patients with Sjogren's syndrome by specific blocking of anti-idiotypic antibodies to La/SSB antigenic...

    ID: 1692578

    Description: epitope description:FRFLALKLYFSFTRP host organism:Homo sapiens

    Publication: 12428060;

  3. Phosphorylation of the nuclear form of varicella-zoster virus immediate-early protein 63 by casein kinase II at serine 186.

    ID: 1692584

    Description: epitope description:IEFRDSDAESSDGEDFIVEE antigen name:Transcriptional regulator ICP22 homolog host organism:Mus musculus BALB/c

    Publication: 19759161;

  4. Detection, epitope-mapping and function of anti-Fas autoantibody in patients with silicosis.

    ID: 1692678

    Description: epitope description:TVETQNLEGLHH antigen name:Tumor necrosis factor receptor superfamily member 6 host organism:Homo sapiens

    Publication: 16108814;

  5. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692680

    Description: epitope description:MASAARLTMMWEE antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  6. Detection, epitope-mapping and function of anti-Fas autoantibody in patients with silicosis.

    ID: 1692694

    Description: epitope description:RCRLCDEGHGLE antigen name:Tumor necrosis factor receptor superfamily member 6 host organism:Homo sapiens

    Publication: 16108814;

  7. Detection, epitope-mapping and function of anti-Fas autoantibody in patients with silicosis.

    ID: 1692697

    Description: epitope description:VCEHCD antigen name:Tumor necrosis factor receptor superfamily member 6 host organism:Homo sapiens

    Publication: 16108814;

  8. Detection, epitope-mapping and function of anti-Fas autoantibody in patients with silicosis.

    ID: 1692702

    Description: epitope description:HGIIKECT antigen name:Tumor necrosis factor receptor superfamily member 6 host organism:Homo sapiens

    Publication: 16108814;

  9. Detection, epitope-mapping and function of anti-Fas autoantibody in patients with silicosis.

    ID: 1692710

    Description: epitope description:YITTIAGVM antigen name:Tumor necrosis factor receptor superfamily member 6 host organism:Homo sapiens

    Publication: 16108814;

  10. Detection, epitope-mapping and function of anti-Fas autoantibody in patients with silicosis.

    ID: 1692712

    Description: epitope description:YITTIAGVM antigen name:Tumor necrosis factor receptor superfamily member 6 host organism:Homo sapiens

    Publication: 16108814;

  11. Detection, epitope-mapping and function of anti-Fas autoantibody in patients with silicosis.

    ID: 1692716

    Description: epitope description:QVKGFV antigen name:Tumor necrosis factor receptor superfamily member 6 host organism:Homo sapiens

    Publication: 16108814;

  12. Detection, epitope-mapping and function of anti-Fas autoantibody in patients with silicosis.

    ID: 1692717

    Description: epitope description:QVKGFV antigen name:Tumor necrosis factor receptor superfamily member 6 host organism:Homo sapiens

    Publication: 16108814;

  13. Detection, epitope-mapping and function of anti-Fas autoantibody in patients with silicosis.

    ID: 1692718

    Description: epitope description:KVQLLRNWH antigen name:Tumor necrosis factor receptor superfamily member 6 host organism:Homo sapiens

    Publication: 16108814;

  14. Detection, epitope-mapping and function of anti-Fas autoantibody in patients with silicosis.

    ID: 1692721

    Description: epitope description:KVQLLRNWH antigen name:Tumor necrosis factor receptor superfamily member 6 host organism:Homo sapiens

    Publication: 16108814;

  15. Detection, epitope-mapping and function of anti-Fas autoantibody in patients with silicosis.

    ID: 1692724

    Description: epitope description:NWHQLHGKKEAY antigen name:Tumor necrosis factor receptor superfamily member 6 host organism:Homo sapiens

    Publication: 16108814;

  16. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692736

    Description: epitope description:MWEEVTCPICLDPFVE antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  17. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692740

    Description: epitope description:EEVTCPICLDPFVEPVSIECGHSF antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  18. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692742

    Description: epitope description:EEVTCPICLDPFVEPVSIECGHSF antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  19. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692747

    Description: epitope description:EPVSIECGHSFCQECI antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  20. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692755

    Description: epitope description:ECISQVGKGGGSVCAV antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  21. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692780

    Description: epitope description:AVHGERLHLFCEKDGKALCWVCAQ antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  22. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692783

    Description: epitope description:VHGERLHLFCEKDGKA antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  23. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692785

    Description: epitope description:VHGERLHLFCEKDGKA antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  24. Cross-recognition between histones and La/SSB may account for anti-DNA reactivity in SLE patients.

    ID: 1692791

    Description: epitope description:GSGKGKVQFQGKKTKF + ACET(G1) antigen name:Lupus La protein host organism:Homo sapiens

    Publication: 16178873;

  25. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692821

    Description: epitope description:RADWKKTVETQKSRIHA antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  26. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692842

    Description: epitope description:SQALQELISELDRRCHS antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  27. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692843

    Description: epitope description:CHSSALELLQEVIIV antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  28. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692860

    Description: epitope description:GLKKMLRTCAVHITLD antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  29. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692883

    Description: epitope description:FHSGKHYWEVDVTGKE antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  30. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692888

    Description: epitope description:GKEAWDLGVCRDSVRRKG antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  31. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692903

    Description: epitope description:PQTPLHLQVPPCQVGIFLD antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  32. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692907

    Description: epitope description:PQTPLHLQVPPCQVGIFLD antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  33. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692910

    Description: epitope description:LDYEAGMVSFYNI antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  34. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692915

    Description: epitope description:NITDHGSLIYSFSECAF antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  35. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692917

    Description: epitope description:NITDHGSLIYSFSECAF antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  36. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692920

    Description: epitope description:CAFTGPLRPFFSPGFN antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  37. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692928

    Description: epitope description:CPLNIGSQGSTDY antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  38. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692948

    Description: epitope description:VCEKLCNEKLLKKARIHPFHI antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 16356190;

  39. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692953

    Description: epitope description:KLIVCGMTSNGFTIADPDDRGMLD antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 16356190;

  40. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692963

    Description: epitope description:TGALDVIRNFTLDMI antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 16356190;

  41. Epitopes of the p70 and p80 (Ku) lupus autoantigens.

    ID: 1692996

    Description: epitope description:LTLPKVEAMNKRLGSLVDEFKELVYPPDYN antigen name:X-ray repair cross-complementing protein 6 host organism:Mus musculus BALB/c antibody ...

    Publication: 1707916;

  42. Epitopes of the p70 and p80 (Ku) lupus autoantigens.

    ID: 1692997

    Description: epitope description:SEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD antigen name:X-ray repair cross-complementing protein 6 host organism:Mus muscu...

    Publication: 1707916;

  43. A repeated proline-rich sequence in Sm B/B' and N is a dominant epitope recognized by human and murine autoantibodies.

    ID: 1693005

    Description: epitope description:APAMIPP antigen name:Glutamate decarboxylase 1 host organism:Homo sapiens

    Publication: 1708261;

  44. A repeated proline-rich sequence in Sm B/B' and N is a dominant epitope recognized by human and murine autoantibodies.

    ID: 1693006

    Description: epitope description:PPGAMPP antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 1708261;

  45. RNA recognition motif (RRM) of La/SSB: the bridge for interparticle spreading of autoimmune response to U1-RNP.

    ID: 1693030

    Description: epitope description:TLHKAFKGSIFVVFDSIESA antigen name:Lupus La protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19838329;

  46. RNA recognition motif (RRM) of La/SSB: the bridge for interparticle spreading of autoimmune response to U1-RNP.

    ID: 1693031

    Description: epitope description:TLHKAFKGSIFVVFDSIESA antigen name:Lupus La protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19838329;

  47. Mapping of epitopes on U1 snRNP polypeptide A with synthetic peptides and autoimmune sera.

    ID: 1693434

    Description: epitope description:SQFGQILDILVSRSLKMRGQAFVI antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 1717192;

  48. Biological activity of IgE specific for cross-reactive carbohydrate determinants.

    ID: 1693440

    Description: epitope description:alpha-L-Fucp-(1->3)-[alpha-D-Manp-(1->6)-[beta-D-Xylp-(1->2)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)]-D-GlcpNAc antigen name:Aci...

    Publication: 12704374;

  49. Mapping of epitopes on U1 snRNP polypeptide A with synthetic peptides and autoimmune sera.

    ID: 1693443

    Description: epitope description:MAVPETRPNHT antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 1717192;

  50. Mapping of epitopes on U1 snRNP polypeptide A with synthetic peptides and autoimmune sera.

    ID: 1693444

    Description: epitope description:SQFGQILDILVSRSLKMRGQAFVI antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 1717192;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston