Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Identification of serotype-specific and nonserotype-specific B-cell epitopes of coxsackie B virus using synthetic peptides.

    ID: 1482297

    Description: epitope description:RHVNAGSTGPIKSTI antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7513917;

  2. Neutralizing epitopes of type O foot-and-mouth disease virus. II. Mapping three conformational sites with synthetic peptide reagents.

    ID: 1482306

    Description: epitope description:N143, L144, R145, G146, R200, H201, K202, Q203, K204, I205, V206, A207, P208, V209, K210, Q211, T212, L213 antigen name:Genome po...

    Publication: 2471812;

  3. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482314

    Description: epitope description:YSRNAVPNLRGDLQVLAQKVARTLPTSFNY antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;

  4. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482317

    Description: epitope description:YSRNAVPNLRGDLQVLAQKVARTLPTSFNY antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;

  5. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482318

    Description: epitope description:YSRNAVPNLRGDLQVLAQKVARTLPTSFNY antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;

  6. Identification of serotype-specific and nonserotype-specific B-cell epitopes of coxsackie B virus using synthetic peptides.

    ID: 1482348

    Description: epitope description:IKSTIRIYFKPKHVK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7513917;

  7. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482353

    Description: epitope description:TAYTASARRGDLAHLAAAHARHLPTSFNF antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;

  8. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482355

    Description: epitope description:TAYTASARRGDLAHLAAAHARHLPTSFNF antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;

  9. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482357

    Description: epitope description:TAYTASARRGDLAHLAAAHARHLPTSFNF antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;

  10. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482360

    Description: epitope description:YKPTGTAPRENIRGDLATLAARIASETHIPTTFNY antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:ant...

    Publication: 2155177;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston