A sequence in subdomain 2 of DBL1alpha of Plasmodium falciparum erythrocyte membrane protein 1 induces strain transcending antibodies.

ID: 1970888

Description: epitope description:KLQTLTLHQVREYWWALNRKEVWKA antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Rattus

A sequence in subdomain 2 of DBL1alpha of Plasmodium falciparum erythrocyte membrane protein 1 induces strain transcending antibodies.

ID: 1970894

Description: epitope description:REYWWALNRKEVWKA antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Oryctolagus cuniculus

A sequence in subdomain 2 of DBL1alpha of Plasmodium falciparum erythrocyte membrane protein 1 induces strain transcending antibodies.

ID: 1970896

Description: epitope description:REDWWAINRKEVWKA antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I218) host organism:Oryctolagus cuniculus

Structure and properties of a complex of alpha-synuclein and a single-domain camelid antibody.

ID: 1970929

Description: epitope description:YEPEA antigen name:Alpha-synuclein host organism:Camelus dromedarius antibody name:NbSyn2

Low levels of IgM antibodies to oxidized cardiolipin increase and high levels decrease risk of cardiovascular disease among 60-year olds: a prospectiv...

ID: 1970932

Description: epitope description:phosphocholine host organism:Homo sapiens

A broadly cross-reactive monoclonal antibody against an epitope on the n-terminus of meningococcal fHbp.

ID: 1970935

Description: epitope description:G140 antigen name:Other Neisseria meningitidis protein host organism:Mus musculus BALB/c antibody name:JAR3, JAR5

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976759

Description: epitope description:EGEAKCGSDKIRDYG antigen name:Erythrocyte membrane protein 1 (PfEMP1), truncated host organism:Rattus norvegicus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976768

Description: epitope description:KSAGGACAPFRRQNL antigen name:Erythrocyte membrane protein 1 (PfEMP1), truncated host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976787

Description: epitope description:NVLVTAKYEGDSIVN antigen name:Erythrocyte membrane protein 1 (PfEMP1), truncated host organism:Rattus norvegicus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976794

Description: epitope description:IVNNHPDKNSSGNKS antigen name:Erythrocyte membrane protein 1 (PfEMP1), truncated host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976795

Description: epitope description:IVNNHPDKNSSGNKS antigen name:Erythrocyte membrane protein 1 (PfEMP1), truncated host organism:Rattus norvegicus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976796

Description: epitope description:HPDKNSSGNKSSICT antigen name:Erythrocyte membrane protein 1 (PfEMP1), truncated host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976799

Description: epitope description:NSSGNKSSICTALAR antigen name:Erythrocyte membrane protein 1 (PfEMP1), truncated host organism:Rattus norvegicus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976801

Description: epitope description:NKSSICTALARSFAD antigen name:Erythrocyte membrane protein 1 (PfEMP1), truncated host organism:Rattus norvegicus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976804

Description: epitope description:LARSFADIGDIVRGR antigen name:Erythrocyte membrane protein 1 (PfEMP1), truncated host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976810

Description: epitope description:DVLEKIATGIYNQEK antigen name:Erythrocyte membrane protein 1 (PfEMP1), truncated host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976818

Description: epitope description:KVEKGLQVVFGKIYN antigen name:Erythrocyte membrane protein 1 (PfEMP1), truncated host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976839

Description: epitope description:LREDWWAINRKEVWK antigen name:Erythrocyte membrane protein 1 (PfEMP1), truncated host organism:Rattus norvegicus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976849

Description: epitope description:APNEANFFRNISGNM antigen name:Erythrocyte membrane protein 1 (PfEMP1), truncated host organism:Rattus norvegicus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976866

Description: epitope description:TNLDYVPQFLRWFDE antigen name:Erythrocyte membrane protein 1 (PfEMP1), truncated host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976867

Description: epitope description:TNLDYVPQFLRWFDE antigen name:Erythrocyte membrane protein 1 (PfEMP1), truncated host organism:Rattus norvegicus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976870

Description: epitope description:FLRWFDEWAEEFCRI antigen name:Erythrocyte membrane protein 1 (PfEMP1), truncated host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976880

Description: epitope description:KIKLENVKKECRDEP antigen name:Erythrocyte membrane protein 1 (PfEMP1), truncated host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976885

Description: epitope description:KECRDEPNNKYCSGD antigen name:Erythrocyte membrane protein 1 (PfEMP1), truncated host organism:Rattus norvegicus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976888

Description: epitope description:NKYCSGDGHDCKRTY antigen name:Erythrocyte membrane protein 1 (PfEMP1), truncated host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976889

Description: epitope description:NKYCSGDGHDCKRTY antigen name:Erythrocyte membrane protein 1 (PfEMP1), truncated host organism:Rattus norvegicus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976895

Description: epitope description:RTYLKDNTIFIDLNC antigen name:Erythrocyte membrane protein 1 (PfEMP1), truncated host organism:Rattus norvegicus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976912

Description: epitope description:MGSSHSTNDTKSPTL antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8IAK2) host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976918

Description: epitope description:EQQLKGTLSRAQFVD antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8IAK2) host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976926

Description: epitope description:LSSRYGYVRNSDGNS antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8IAK2) host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976940

Description: epitope description:NIKTGYNEGRKPCYG antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8IAK2) host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976952

Description: epitope description:AEAYCNSDKIRGNEN antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8IAK2) host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976970

Description: epitope description:QNLEFLDNKNTNTTH antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8IAK2) host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976972

Description: epitope description:FLDNKNTNTTHDLLG antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8IAK2) host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976974

Description: epitope description:KNTNTTHDLLGNVLV antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8IAK2) host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976982

Description: epitope description:VLVTAKYEGNYIVND antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8IAK2) host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1976984

Description: epitope description:AKYEGNYIVNDHPDK antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8IAK2) host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1977004

Description: epitope description:DIVRGRDMFLPNKDD antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8IAK2) host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1977008

Description: epitope description:FLPNKDDKVQKGLQV antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8IAK2) host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1977038

Description: epitope description:WKALTCSAPYYADYF antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8IAK2) host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1977044

Description: epitope description:VLENIGIKIYNQEIK antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8IAK2) host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1977060

Description: epitope description:YLDYVPQFLRWFEEW antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8IAK2) host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1977064

Description: epitope description:LRWFEEWSEEFCRIK antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8IAK2) host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1977066

Description: epitope description:IGIKIYNQEIKKKNP antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8IAK2) host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1977084

Description: epitope description:GDGHDCTQTNLSHNQ antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8IAK2) host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1977096

Description: epitope description:DCPRCQDQCIKYNEW antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8IAK2) host organism:Capra hircus

Analysis of antibody induction upon immunization with distinct NTS-DBL1alpha-domains of PfEMP1 from rosetting Plasmodium falciparum parasites.

ID: 1977098

Description: epitope description:CQDQCIKYNEWIVKK antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8IAK2) host organism:Capra hircus

Cytotoxicity responses to peptide antigens in rheumatoid arthritis and ankylosing spondylitis.

ID: 1977198

Description: epitope description:RPTVRSDIDYRQAESR host organism:Homo sapiens

Identification of conserved neutralizing linear epitopes within the VP1 protein of coxsackievirus A16.

ID: 1977215

Description: epitope description:PTSRDSFAWQTATNP antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Combination peptide immunotherapy based on T-cell epitope mapping reduces allergen-specific IgE and eosinophilia in allergic airway inflammation.

ID: 1977298

Description: epitope description:ISQAVHAAHAEINEAGR antigen name:Gal d 2 host organism:Mus musculus C57BL/6

Prediction and characterization of the linear IgE epitopes for the major soybean allergen beta-conglycinin using immunoinformatics tools.

ID: 1977311

Description: epitope description:HEQREEQEWPRKEEKRGEKGSEEEDE antigen name:Beta-conglycinin, alpha chain (UniProt:P13916) host organism:Homo sapiens

Prediction and characterization of the linear IgE epitopes for the major soybean allergen beta-conglycinin using immunoinformatics tools.

ID: 1977312

Description: epitope description:DEEQQRESEESEDSELRRHKNKNPFL antigen name:Beta-conglycinin, alpha chain (UniProt:P13916) host organism:Homo sapiens

Prediction and characterization of the linear IgE epitopes for the major soybean allergen beta-conglycinin using immunoinformatics tools.

ID: 1977322

Description: epitope description:QRESYFVDAQPKKKEEGNKGRKGPLSSILR antigen name:Beta-conglycinin, alpha chain (UniProt:P13916) host organism:Homo sapiens

Mapping of the IgE and IgG4 sequential epitopes of ovomucoid with a peptide microarray immunoassay.

ID: 1977323

Description: epitope description:AEVDCSRFPNATDKEGKD antigen name:Gal d 1 host organism:Homo sapiens

Mapping of the IgE and IgG4 sequential epitopes of ovomucoid with a peptide microarray immunoassay.

ID: 1977345

Description: epitope description:PMNCSSYANTTSEDGKVMVL antigen name:Gal d 1 host organism:Homo sapiens

Mapping of the IgE and IgG4 sequential epitopes of ovomucoid with a peptide microarray immunoassay.

ID: 1977356

Description: epitope description:VTYDNECLLCAHKVEQGASV antigen name:Gal d 1 host organism:Homo sapiens

Mapping of the IgE and IgG4 sequential epitopes of ovomucoid with a peptide microarray immunoassay.

ID: 1977358

Description: epitope description:CLLCAHKVEQGASVDKRHDG antigen name:Gal d 1 host organism:Homo sapiens

Mapping of the IgE and IgG4 sequential epitopes of ovomucoid with a peptide microarray immunoassay.

ID: 1977365

Description: epitope description:CRKELAAVSVDCSEYPKPDC antigen name:Gal d 1 host organism:Homo sapiens

Mapping of the IgE and IgG4 sequential epitopes of ovomucoid with a peptide microarray immunoassay.

ID: 1977367

Description: epitope description:AVSVDCSEYPKPDCTAEDRP antigen name:Gal d 1 host organism:Homo sapiens

Mapping of the IgE and IgG4 sequential epitopes of ovomucoid with a peptide microarray immunoassay.

ID: 1977371

Description: epitope description:DCTAEDRPLCGSDNKTYGNK antigen name:Gal d 1 host organism:Homo sapiens

Mapping of the IgE and IgG4 sequential epitopes of ovomucoid with a peptide microarray immunoassay.

ID: 1977377

Description: epitope description:NKCNFCNAVVESNGTLTLSH antigen name:Gal d 1 host organism:Homo sapiens

Production and characterization of mouse monoclonal antibodies against lysis protein E of phiX174.

ID: 1977449

Description: epitope description:VRLKPLNCSR antigen name:Escherichia virus phiX174 protein host organism:Mus musculus BALB/c antibody name:E-A5

Production and characterization of mouse monoclonal antibodies against lysis protein E of phiX174.

ID: 1977456

Description: epitope description:VRLKPLNCSR antigen name:Escherichia virus phiX174 protein host organism:Mus musculus BALB/c antibody name:E-A5

Prediction and characterization of the linear IgE epitopes for the major soybean allergen beta-conglycinin using immunoinformatics tools.

ID: 1977469

Description: epitope description:SEDKPFNLRSRDPIYSNKLGKFFEITPEKN antigen name:Beta-conglycinin, alpha chain (UniProt:P13916) host organism:Homo sapiens

Immune responses elicited by apoB-100-derived peptides in mice.

ID: 1977542

Description: epitope description:IEIGLEGKGFEPTLEALFGK antigen name:Apolipoprotein B-100 host organism:Mus musculus Apolipoprotein E null

Intracellular accumulation of aggregated pyroglutamate amyloid beta: convergence of aging and Abeta pathology at the lysosome.

ID: 1977544

Description: epitope description:EFRHDS antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:6E10

Autoantibodies recognizing the amino terminal 1-17 segment of CENP-A display unique specificities in systemic sclerosis.

ID: 1977633

Description: epitope description:MGPRRRSRKPEAPRRRS antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens

Structure of a classical broadly neutralizing stem antibody in complex with a pandemic H2 influenza virus hemagglutinin.

ID: 1977786

Description: epitope description:A: H43, K45, I47, T302, L303, P304, T329; B: V358, D359, G360, W361, K378, T381, Q382, K383, F385, D386, V392, I396 antigen name:H...

Structure of a classical broadly neutralizing stem antibody in complex with a pandemic H2 influenza virus hemagglutinin.

ID: 1977790

Description: epitope description:A: H43, K45, I47, T302, L303, P304, T329; B: V358, D359, G360, W361, K378, T381, Q382, K383, F385, D386, V392, I396 antigen name:H...

Structure of a classical broadly neutralizing stem antibody in complex with a pandemic H2 influenza virus hemagglutinin.

ID: 1977794

Description: epitope description:A: H43, K45, I47, T302, L303, P304, T329; B: V358, D359, G360, W361, K378, T381, Q382, K383, F385, D386, V392, I396 antigen name:H...

Structure of a classical broadly neutralizing stem antibody in complex with a pandemic H2 influenza virus hemagglutinin.

ID: 1977798

Description: epitope description:A: H43, K45, I47, T302, L303, P304, T329; B: V358, D359, G360, W361, K378, T381, Q382, K383, F385, D386, V392, I396 antigen name:H...

Structure of a classical broadly neutralizing stem antibody in complex with a pandemic H2 influenza virus hemagglutinin.

ID: 1977800

Description: epitope description:A: H43, K45, I47, T302, L303, P304, T329; B: V358, D359, G360, W361, K378, T381, Q382, K383, F385, D386, V392, I396 antigen name:H...

Structure of a classical broadly neutralizing stem antibody in complex with a pandemic H2 influenza virus hemagglutinin.

ID: 1977803

Description: epitope description:A: H43, K45, I47, T302, L303, P304, T329; B: V358, D359, G360, W361, K378, T381, Q382, K383, F385, D386, V392, I396 antigen name:H...

Multiple sites of the cleavage of 21- and 25-mer encephalytogenic oligopeptides corresponding to human myelin basic protein (MBP) by specific anti-MBP...

ID: 1975124

Description: epitope description:YLASASTMDHARHGFLPRRHR antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens

Multiple sites of the cleavage of 21- and 25-mer encephalytogenic oligopeptides corresponding to human myelin basic protein (MBP) by specific anti-MBP...

ID: 1975126

Description: epitope description:YLASASTMDHARHGFLPRRHR antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens

Multiple sites of the cleavage of 21- and 25-mer encephalytogenic oligopeptides corresponding to human myelin basic protein (MBP) by specific anti-MBP...

ID: 1975128

Description: epitope description:AQGTLSKIFKLGGRDSRSGSPMARR antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens

Multiple sites of the cleavage of 21- and 25-mer encephalytogenic oligopeptides corresponding to human myelin basic protein (MBP) by specific anti-MBP...

ID: 1975129

Description: epitope description:AQGTLSKIFKLGGRDSRSGSPMARR antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens

Effects of amino acid substitutions in the VP2 B-C loop on antigenicity and pathogenicity of serotype Asia1 foot-and-mouth disease virus.

ID: 1975134

Description: epitope description:D358 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1B4

Mucosal tolerance to a combination of ApoB and HSP60 peptides controls plaque progression and stabilizes vulnerable plaque in Apob(tm2Sgy)Ldlr(tm1Her)...

ID: 1975138

Description: epitope description:IEIGLEGKGFEPTLEALFGK antigen name:Apolipoprotein B-100 host organism:Mus musculus Apolipoprotein B null

Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme...

ID: 1975147

Description: epitope description:TDELNQQRDDITRAI antigen name:Possible Mce-family lipoprotein LprK (Mce-family lipoprotein Mce1E) host organism:Oryctolagus cunicul...

Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme...

ID: 1975149

Description: epitope description:TDELNQQRDDITRAI antigen name:Possible Mce-family lipoprotein LprK (Mce-family lipoprotein Mce1E) host organism:Oryctolagus cunicul...

Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

ID: 1975167

Description: epitope description:LIPLMALSTI antigen name:Protective antigen host organism:Mus musculus A/J

Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

ID: 1975173

Description: epitope description:SSTGNLEVIQ antigen name:Protective antigen host organism:Mus musculus A/J

Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

ID: 1975186

Description: epitope description:SQGLLGYYFS antigen name:Protective antigen host organism:Mus musculus A/J

Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

ID: 1975198

Description: epitope description:TGDLSIPSSE antigen name:Protective antigen host organism:Mus musculus A/J

Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

ID: 1975199

Description: epitope description:DLSIPSSELE antigen name:Protective antigen host organism:Mus musculus A/J

Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

ID: 1975207

Description: epitope description:QYFQSAIWSG antigen name:Protective antigen host organism:Mus musculus A/J

Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

ID: 1975210

Description: epitope description:IWSGFIKVKK antigen name:Protective antigen host organism:Mus musculus A/J

Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

ID: 1975215

Description: epitope description:SDEYTFATSA antigen name:Protective antigen host organism:Mus musculus A/J

Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

ID: 1975222

Description: epitope description:TMWVDDQEVI antigen name:Protective antigen host organism:Mus musculus A/J

Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

ID: 1975229

Description: epitope description:NSNKIRLEKG antigen name:Protective antigen host organism:Mus musculus A/J

Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

ID: 1975230

Description: epitope description:NKIRLEKGRL antigen name:Protective antigen host organism:Mus musculus A/J

Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

ID: 1975231

Description: epitope description:IRLEKGRLYQ antigen name:Protective antigen host organism:Mus musculus A/J

Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

ID: 1975232

Description: epitope description:LEKGRLYQIK antigen name:Protective antigen host organism:Mus musculus A/J

Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

ID: 1975237

Description: epitope description:IQYQRENPTE antigen name:Protective antigen host organism:Mus musculus A/J

Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

ID: 1975246

Description: epitope description:WTDSQNKKEV antigen name:Protective antigen host organism:Mus musculus A/J

Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

ID: 1975248

Description: epitope description:QNKKEVISSD antigen name:Protective antigen host organism:Mus musculus A/J

Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

ID: 1975250

Description: epitope description:EVISSDNLQL antigen name:Protective antigen host organism:Mus musculus A/J

Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

ID: 1975257

Description: epitope description:QKSSNSRKKR antigen name:Protective antigen host organism:Mus musculus A/J

Stochastic humoral immunity to Bacillus anthracis protective antigen: identification of anti-peptide IgG correlating with seroconversion to Lethal Tox...

ID: 1975260

Description: epitope description:RKKRSTSAGP antigen name:Protective antigen host organism:Mus musculus A/J