Development of recombinant diagnostic reagents based on pp85(U14) and p86(U11) proteins to detect the human immune response to human herpesvirus 7 inf...

ID: 1379034

Description: epitope description:SRPGSTTPSGNSARYGNNT antigen name:U14 protein host organism:Mus musculus BALB/c antibody name:MAb 5E1

Mapping of the epitopes of Epstein-Barr virus gp350 using monoclonal antibodies and recombinant proteins expressed in Escherichia coli defines three a...

ID: 1379106

Description: epitope description:PASQDMPTNTTDITYV antigen name:Envelope glycoprotein GP350 host organism:Mus musculus antibody name:BMA-17

Characterization of monoclonal antibodies recognizing amino- and carboxy-terminal epitopes of the herpes simplex virus UL42 protein.

ID: 1379120

Description: epitope description:MTDSPGGVAP antigen name:DNA polymerase processivity factor host organism:Mus musculus BALB/c antibody name:13

Characterization of monoclonal antibodies recognizing amino- and carboxy-terminal epitopes of the herpes simplex virus UL42 protein.

ID: 1379122

Description: epitope description:GDRGILIHNTIFGEQVFLPLEHSQFSRYRWRGPTAAFLSLVDQKRSL antigen name:DNA polymerase processivity factor host organism:Mus musculus BALB/c ...

Characterization of monoclonal antibodies recognizing amino- and carboxy-terminal epitopes of the herpes simplex virus UL42 protein.

ID: 1379124

Description: epitope description:GDRGILIHNTIFGEQVFLPLEHSQFSRYRWRGPTAAFLSLVDQKRSL antigen name:DNA polymerase processivity factor host organism:Mus musculus BALB/c ...