Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Location of neutralizing epitopes defined by monoclonal antibodies generated against the outer capsid polypeptide, VP1, of foot-and-mouth disease viru...

    ID: 1482481

    Description: epitope description:GDFGSLAPRVARQLPASFNYGAIK antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:6HE4, 7SF3

    Publication: 6085200;

  2. Binding of neutralizing monoclonal antibodies to regions of the fusion protein of respiratory syncytial virus expressed in Escherichia coli.

    ID: 1482488

    Description: epitope description:PITNDQKK antigen name:Fusion glycoprotein F0 host organism:Mus musculus antibody name:RS348

    Publication: 7506297;

  3. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482491

    Description: epitope description:GSGVRGDFG antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 10501234;

  4. Influence of the C terminus of the small protein subunit of bean pod mottle virus on the antigenicity of the virus determined using monoclonal antibod...

    ID: 1482495

    Description: epitope description:AFSVPQANARSSENAESSA antigen name:RNA2 polyprotein host organism:Oryctolagus cuniculus antibody name:anti-180-198

    Publication: 1716655;

  5. Influence of the C terminus of the small protein subunit of bean pod mottle virus on the antigenicity of the virus determined using monoclonal antibod...

    ID: 1482499

    Description: epitope description:ANARSSENAESSA antigen name:RNA2 polyprotein host organism:Oryctolagus cuniculus antibody name:anti-186-198

    Publication: 1716655;

  6. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482502

    Description: epitope description:DFGSLAPRVA antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 10501234;

  7. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482510

    Description: epitope description:DFGSLAPRVA antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 10501234;

  8. Priming for and induction of anti-poliovirus neutralizing antibodies by synthetic peptides.

    ID: 1482513

    Description: epitope description:STTNKDK antigen name:Genome polyprotein host organism:Mus musculus antibody name:1 BM 55-6

    Publication: 6310403;

  9. Characterization of HTLV envelope seroreactivity in large granular lymphocyte leukemia.

    ID: 1482520

    Description: epitope description:QEQCRFPNITNSHVSILQERPPLENRVLTGWGLN antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 15725471;

  10. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482531

    Description: epitope description:NLRGDLQVLA antigen name:Polyprotein host organism:Cavia porcellus

    Publication: 10501234;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston