Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. A G-quadruplex-containing RNA activates fluorescence in a GFP-like fluorophore.

    ID: 2116307

    Description: epitope description:5'-GAAACAC-3' RNA fragment host organism:Mus musculus antibody name:BL3-6

    Publication: 24952597;

  2. A G-quadruplex-containing RNA activates fluorescence in a GFP-like fluorophore.

    ID: 2116308

    Description: epitope description:5'-GAAACAC-3' RNA fragment host organism:Mus musculus antibody name:BL3-6

    Publication: 24952597;

  3. Immunoglobulin E epitope mapping by microarray immunoassay reveals differences in immune response to genetic variants of caseins from different rumina...

    ID: 2116319

    Description: epitope description:PFPKYPVEPFTESQSL antigen name:Bos d 11 host organism:Homo sapiens

    Publication: 24485684;

  4. Immunoglobulin E epitope mapping by microarray immunoassay reveals differences in immune response to genetic variants of caseins from different rumina...

    ID: 2116326

    Description: epitope description:KYIPIQYVLSRYPSYGLNYY antigen name:Bos d 12 host organism:Homo sapiens

    Publication: 24485684;

  5. Immunoglobulin E epitope mapping by microarray immunoassay reveals differences in immune response to genetic variants of caseins from different rumina...

    ID: 2116329

    Description: epitope description:ALINNQFLPYPYYAKPAAVR antigen name:Bos d 12 host organism:Homo sapiens

    Publication: 24485684;

  6. Immunoglobulin E epitope mapping by microarray immunoassay reveals differences in immune response to genetic variants of caseins from different rumina...

    ID: 2116330

    Description: epitope description:SDIPNPIGSENSEK antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 24485684;

  7. Identification of linear human B-cell epitopes of tick-borne encephalitis virus.

    ID: 2116337

    Description: epitope description:GRKTASFTVSSEKTILTM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24946852;

  8. Identification of linear human B-cell epitopes of tick-borne encephalitis virus.

    ID: 2116988

    Description: epitope description:ENPAKTREYCLHAKLSDT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24946852;

  9. Identification of linear human B-cell epitopes of tick-borne encephalitis virus.

    ID: 2116997

    Description: epitope description:GLLVISGLFPVSIPITAA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24946852;

  10. Identification of linear human B-cell epitopes of tick-borne encephalitis virus.

    ID: 2117000

    Description: epitope description:LALPWKHEGAQNWNNAER antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24946852;

  11. Identification of linear human B-cell epitopes of tick-borne encephalitis virus.

    ID: 2117008

    Description: epitope description:PWLAWHVAANVSSVTDRS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24946852;

  12. Identification of linear human B-cell epitopes of tick-borne encephalitis virus.

    ID: 2117010

    Description: epitope description:SEWTNVDIQPARSWGTYV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24946852;

  13. Identification of linear human B-cell epitopes of tick-borne encephalitis virus.

    ID: 2117013

    Description: epitope description:WSIHASGAWMTTEDMLDV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24946852;

  14. Identification of linear human B-cell epitopes of tick-borne encephalitis virus.

    ID: 2117022

    Description: epitope description:SEWTNVDIQPARSWGTYV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24946852;

  15. Identification of linear human B-cell epitopes of tick-borne encephalitis virus.

    ID: 2117030

    Description: epitope description:GLNTFTNMEAQLIRQMEG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24946852;

  16. Identification of linear human B-cell epitopes of tick-borne encephalitis virus.

    ID: 2117055

    Description: epitope description:CGLFGKGSIVACVKAACE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24946852;

  17. Identification of linear human B-cell epitopes of tick-borne encephalitis virus.

    ID: 2117057

    Description: epitope description:EFGAPHAVKMDVYNLGDQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 24946852;

  18. Immunoglobulin E epitope mapping by microarray immunoassay reveals differences in immune response to genetic variants of caseins from different rumina...

    ID: 2117075

    Description: epitope description:SISSSEEIVPISVEQ antigen name:Bubalus bubalis (domestic water buffalo) protein host organism:Homo sapiens

    Publication: 24485684;

  19. Immunoglobulin E epitope mapping by microarray immunoassay reveals differences in immune response to genetic variants of caseins from different rumina...

    ID: 2117087

    Description: epitope description:SSEESITRINKKIEKFQSEE + PHOS(S18) antigen name:Bos d 11 host organism:Homo sapiens

    Publication: 24485684;

  20. Identification of a free core B-cell epitope in the lipopolysaccharide of Francisella tularensis

    ID: 2117114

    Description: epitope description:alpha-D-GalNAc-(1->2)-beta-D-Man-(1->4)-[beta-D-Glc-(1->2)]-alpha-D-Man-(1->5)-alpha-Kdo antigen name:lipopolysaccharide host orga...

  21. Identification of a free core B-cell epitope in the lipopolysaccharide of Francisella tularensis

    ID: 2117116

    Description: epitope description:alpha-D-GalNAc-(1->2)-beta-D-Man-(1->4)-[beta-D-Glc-(1->2)]-alpha-D-Man-(1->5)-alpha-Kdo antigen name:lipopolysaccharide host orga...

  22. Identification of epitopes of the beta subunit of soybean beta-conglycinin that are antigenic in pigs, dogs, rabbits and fish.

    ID: 2110589

    Description: epitope description:ANIELVGIKEQQQKQK antigen name:Beta-conglycinin, beta chain host organism:Morone chrysops x Morone saxatilis

    Publication: 24415270;

  23. Identification of epitopes of the beta subunit of soybean beta-conglycinin that are antigenic in pigs, dogs, rabbits and fish.

    ID: 2110593

    Description: epitope description:PLEVQRYRAELSEDDV antigen name:Beta-conglycinin, beta chain host organism:Morone chrysops x Morone saxatilis

    Publication: 24415270;

  24. Identification of epitopes of the beta subunit of soybean beta-conglycinin that are antigenic in pigs, dogs, rabbits and fish.

    ID: 2110600

    Description: epitope description:LAFGINAENNQRNFLA antigen name:Beta-conglycinin, beta chain host organism:Morone chrysops x Morone saxatilis

    Publication: 24415270;

  25. Identification of epitopes of the beta subunit of soybean beta-conglycinin that are antigenic in pigs, dogs, rabbits and fish.

    ID: 2110606

    Description: epitope description:QELAFPGSAQDVERLL antigen name:Beta-conglycinin, beta chain host organism:Morone chrysops x Morone saxatilis

    Publication: 24415270;

  26. Identification of epitopes of the beta subunit of soybean beta-conglycinin that are antigenic in pigs, dogs, rabbits and fish.

    ID: 2110612

    Description: epitope description:QKEEGSKGRKGPFPSI antigen name:Beta-conglycinin, beta chain host organism:Morone chrysops x Morone saxatilis

    Publication: 24415270;

  27. Crystal structures of ricin toxin's enzymatic subunit (RTA) in complex with neutralizing and non-neutralizing single-chain antibodies.

    ID: 2110661

    Description: epitope description:Y126, H129, Q133, A136, E137, T140, H141, Q147, N148, R149, Y150, T151, F152, A153, F154, R160, L164, Y189, L196 antigen name:rRNA...

    Publication: 24907552;

  28. Crystal structures of ricin toxin's enzymatic subunit (RTA) in complex with neutralizing and non-neutralizing single-chain antibodies.

    ID: 2110669

    Description: epitope description:Y126, H129, Q133, A136, E137, T140, H141, Q147, N148, R149, Y150, T151, F152, A153, F154, R160, L164, Y189, L196 antigen name:rRNA...

    Publication: 24907552;

  29. Experimental Validation of Multi-Epitope Peptides Including Promising MHC Class I- and II-Restricted Epitopes of Four Known Leishmania infantum Protei...

    ID: 2110716

    Description: epitope description:GNIEGQWALKNHSLVSLSEQVLVSCDNIDD antigen name:Cysteine peptidase A (CPA) host organism:Mus musculus BALB/c

    Publication: 24959167;

  30. Experimental Validation of Multi-Epitope Peptides Including Promising MHC Class I- and II-Restricted Epitopes of Four Known Leishmania infantum Protei...

    ID: 2110718

    Description: epitope description:MSSDSAVAALSAAMTSPQKS antigen name:18 kDa nuclear protein host organism:Mus musculus BALB/c

    Publication: 24959167;

  31. Experimental Validation of Multi-Epitope Peptides Including Promising MHC Class I- and II-Restricted Epitopes of Four Known Leishmania infantum Protei...

    ID: 2110719

    Description: epitope description:AGAKKAGAKKAVRKVATPKK antigen name:18 kDa nuclear protein host organism:Mus musculus BALB/c

    Publication: 24959167;

  32. Experimental Validation of Multi-Epitope Peptides Including Promising MHC Class I- and II-Restricted Epitopes of Four Known Leishmania infantum Protei...

    ID: 2110720

    Description: epitope description:TYEEFSAKLDRLDEEFNRKM antigen name:Kinetoplastid membrane protein-11 host organism:Mus musculus BALB/c

    Publication: 24959167;

  33. Experimental Validation of Multi-Epitope Peptides Including Promising MHC Class I- and II-Restricted Epitopes of Four Known Leishmania infantum Protei...

    ID: 2110721

    Description: epitope description:KIAPQDQDSFLDDQPGVRPIPSFDDMPLHQ antigen name:Probable eukaryotic initiation factor 4A host organism:Mus musculus BALB/c

    Publication: 24959167;

  34. Identification and in vitro reactivity of celiac immunoactive peptides in an apparent gluten-free beer.

    ID: 2110817

    Description: epitope description:QPQLPY antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musculus antibody name:G12

    Publication: 24963630;

  35. Characterization of two antigenic sites recognized by neutralizing monoclonal antibodies directed against the fusion glycoprotein of human respiratory...

    ID: 2110841

    Description: epitope description:K272 antigen name:Fusion glycoprotein F0 host organism:Bos taurus antibody name:MAb B4

    Publication: 1383404;

  36. p-Tau immunotherapy reduces soluble and insoluble tau in aged 3xTg-AD mice.

    ID: 2110848

    Description: epitope description:EFRHDS antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:6E10

    Publication: 24887583;

  37. Characterization of immunological cross-reactivity between enterotoxigenic Escherichia coli heat-stable toxin and human guanylin and uroguanylin.

    ID: 2110868

    Description: epitope description:PGTCEICAYAACTGC antigen name:Guanylin host organism:Oryctolagus cuniculus antibody name:ab14344

    Publication: 24778111;

  38. Characterization of immunological cross-reactivity between enterotoxigenic Escherichia coli heat-stable toxin and human guanylin and uroguanylin.

    ID: 2110872

    Description: epitope description:NSSNYCCELCCNPACTGCY antigen name:Heat-stable enterotoxin A2 (STA2) host organism:Oryctolagus cuniculus

    Publication: 24778111;

  39. Characterization of immunological cross-reactivity between enterotoxigenic Escherichia coli heat-stable toxin and human guanylin and uroguanylin.

    ID: 2110878

    Description: epitope description:NDDCELCVNVACTGC antigen name:Guanylate cyclase activator 2B host organism:Oryctolagus cuniculus

    Publication: 24778111;

  40. Characterization of immunological cross-reactivity between enterotoxigenic Escherichia coli heat-stable toxin and human guanylin and uroguanylin.

    ID: 2110881

    Description: epitope description:NSSNYCCELCCNPACTGCF host organism:Mus musculus BALB/c antibody name:ST:G8

    Publication: 24778111;

  41. Characterization of immunological cross-reactivity between enterotoxigenic Escherichia coli heat-stable toxin and human guanylin and uroguanylin.

    ID: 2110884

    Description: epitope description:NTFYCCELCCNPACAGCY antigen name:Heat-stable enterotoxin ST-IA/ST-P host organism:Mus musculus BALB/c antibody name:ST:G8

    Publication: 24778111;

  42. Characterization of immunological cross-reactivity between enterotoxigenic Escherichia coli heat-stable toxin and human guanylin and uroguanylin.

    ID: 2110887

    Description: epitope description:NSSNYCCELCCNPACTGCY antigen name:Heat-stable enterotoxin A2 (STA2) host organism:Mus musculus BALB/c antibody name:ST:G8

    Publication: 24778111;

  43. Mechanism of action and epitopes of Clostridium difficile toxin B-neutralizing antibody bezlotoxumab revealed by X-ray crystallography.

    ID: 2110988

    Description: epitope description:E1878, Y1887, Q1890, S1900, T1901, E1902, D1903, F1905, D1939, N1941, R1943, G1944, V1946, E1947, P1960, E1961 antigen name:Toxin ...

    Publication: 24821719;

  44. Mechanism of action and epitopes of Clostridium difficile toxin B-neutralizing antibody bezlotoxumab revealed by X-ray crystallography.

    ID: 2110991

    Description: epitope description:Y2009, Y2018, E2021, N2031, T2032, E2033, D2034, G2035, F2036 antigen name:Toxin B host organism:Mus musculus HuMAb (Medarex) anti...

    Publication: 24821719;

  45. Mechanism of action and epitopes of Clostridium difficile toxin B-neutralizing antibody bezlotoxumab revealed by X-ray crystallography.

    ID: 2110997

    Description: epitope description:Y2009, Y2018, E2021, N2031, T2032, E2033, D2034, G2035, F2036 antigen name:Toxin B host organism:Mus musculus HuMAb (Medarex) anti...

    Publication: 24821719;

  46. Lower motor neuron syndrome associated with IgG anti-GM1 antibodies revisited.

    ID: 2111002

    Description: epitope description:ganglioside GM2 host organism:Homo sapiens

    Publication: 24841627;

  47. Lower motor neuron syndrome associated with IgG anti-GM1 antibodies revisited.

    ID: 2111003

    Description: epitope description:ganglioside X2 host organism:Homo sapiens

    Publication: 24841627;

  48. Effects of reduction in the alpha-gal antigen on bony union: a model of xenobone graft using GalT knockout mouse.

    ID: 2111014

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Mus musculus alpha-galactosyl transferase null

    Publication: 24635119;

  49. Effects of reduction in the alpha-gal antigen on bony union: a model of xenobone graft using GalT knockout mouse.

    ID: 2111015

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Mus musculus alpha-galactosyl transferase null

    Publication: 24635119;

  50. Non-stoichiometric O-acetylation of Shigella flexneri 2a O-specific polysaccharide: synthesis and antigenicity.

    ID: 2111076

    Description: epitope description:alpha-L-Rhap-(1->2)-alpha-L-Rhap-(1->3)-[alpha-D-Glcp-(1->4)]-alpha-L-Rhap-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-L-Rhap3Ac-(1->2)-alp...

    Publication: 24836582;

  51. Non-stoichiometric O-acetylation of Shigella flexneri 2a O-specific polysaccharide: synthesis and antigenicity.

    ID: 2111078

    Description: epitope description:alpha-L-Rhap-(1->2)-alpha-L-Rhap-(1->3)-[alpha-D-Glcp-(1->4)]-alpha-L-Rhap-(1->3)-beta-D-Glcp6,NAc2-(1->2)-alpha-L-Rhap-(1->2)-alp...

    Publication: 24836582;

  52. Epitope mapping of the HSP83.1 protein of Leishmania braziliensis discloses novel targets for immunodiagnosis of tegumentary and visceral clinical for...

    ID: 2111199

    Description: epitope description:EVAEAPPAEAAPA antigen name:Heat shock protein 83-1 host organism:Homo sapiens

    Publication: 24807053;

  53. Epitope mapping of the HSP83.1 protein of Leishmania braziliensis discloses novel targets for immunodiagnosis of tegumentary and visceral clinical for...

    ID: 2111208

    Description: epitope description:VTEGGEDKKK antigen name:Heat shock protein 83-1 host organism:Canis lupus familiaris

    Publication: 24807053;

  54. Influenza hemagglutinin stem-fragment immunogen elicits broadly neutralizing antibodies and confers heterologous protection.

    ID: 2112936

    Description: epitope description:A: H25, H45, V46, N47, L496, S306, L307, P308, T333; B: D363, G364, W365, Q382, T385, Q386, I389, D390, T393, V396, N397, I400; an...

    Publication: 24927560;

  55. Influenza hemagglutinin stem-fragment immunogen elicits broadly neutralizing antibodies and confers heterologous protection.

    ID: 2112939

    Description: epitope description:A: H45, S46, S306, T333; B: V362, D363, G364, W365, L382, K385, T386, Q387, N388, I389, D390, T393, N397, I400, E401 antigen name:...

    Publication: 24927560;

  56. Influenza hemagglutinin stem-fragment immunogen elicits broadly neutralizing antibodies and confers heterologous protection.

    ID: 2112949

    Description: epitope description:A: H45, S46, S306, T333; B: V362, D363, G364, W365, L382, K385, T386, Q387, N388, I389, D390, T393, N397, I400, E401 antigen name:...

    Publication: 24927560;

  57. Lower motor neuron syndrome associated with IgG anti-GM1 antibodies revisited.

    ID: 2112953

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)-[alpha-N-acetylneuraminosyl-(2->3...

    Publication: 24841627;

  58. Identification of human neutralizing antibodies against MERS-CoV and their role in virus adaptive evolution.

    ID: 2112961

    Description: epitope description:P547 antigen name:spike glycoprotein [Human betacoronavirus 2c EMC/2012] host organism:Homo sapiens antibody name:1E9-Fc

    Publication: 24778221;

  59. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2112970

    Description: epitope description:LALFVTMWTDVGL antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  60. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2112973

    Description: epitope description:LFVTMWTDVGLCK antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  61. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2112975

    Description: epitope description:VTMWTDVGLCKKR antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  62. Identification of human neutralizing antibodies against MERS-CoV and their role in virus adaptive evolution.

    ID: 2112986

    Description: epitope description:R542 antigen name:spike glycoprotein [Human betacoronavirus 2c EMC/2012] host organism:Homo sapiens antibody name:1F8-Fc

    Publication: 24778221;

  63. Identification of human neutralizing antibodies against MERS-CoV and their role in virus adaptive evolution.

    ID: 2112988

    Description: epitope description:R542 antigen name:spike glycoprotein [Human betacoronavirus 2c EMC/2012] host organism:Homo sapiens antibody name:1F8-Fc

    Publication: 24778221;

  64. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2112995

    Description: epitope description:GGWNTGGSRYPGQ antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  65. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113002

    Description: epitope description:GSRYPGQGSPGGN antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  66. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113004

    Description: epitope description:RYPGQGSPGGNRY antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  67. Identification of human neutralizing antibodies against MERS-CoV and their role in virus adaptive evolution.

    ID: 2113009

    Description: epitope description:R542, I1229 antigen name:spike glycoprotein [Human betacoronavirus 2c EMC/2012] host organism:Homo sapiens antibody name:1F8-IgG

    Publication: 24778221;

  68. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113018

    Description: epitope description:YPPQGGTWGQPHG antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  69. Identification of human neutralizing antibodies against MERS-CoV and their role in virus adaptive evolution.

    ID: 2113032

    Description: epitope description:L506, T512 antigen name:spike glycoprotein [Human betacoronavirus 2c EMC/2012] host organism:Homo sapiens antibody name:3B12-Fc

    Publication: 24778221;

  70. Identification of human neutralizing antibodies against MERS-CoV and their role in virus adaptive evolution.

    ID: 2113033

    Description: epitope description:L506, T512 antigen name:spike glycoprotein [Human betacoronavirus 2c EMC/2012] host organism:Homo sapiens antibody name:3B12-Fc

    Publication: 24778221;

  71. Identification of human neutralizing antibodies against MERS-CoV and their role in virus adaptive evolution.

    ID: 2113039

    Description: epitope description:R542 antigen name:spike glycoprotein [Human betacoronavirus 2c EMC/2012] host organism:Homo sapiens antibody name:3A1-Fc

    Publication: 24778221;

  72. Identification of human neutralizing antibodies against MERS-CoV and their role in virus adaptive evolution.

    ID: 2113043

    Description: epitope description:Y540 antigen name:spike glycoprotein [Human betacoronavirus 2c EMC/2012] host organism:Homo sapiens antibody name:3C12-Fc

    Publication: 24778221;

  73. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113046

    Description: epitope description:GWGQPHGGSWGQP antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  74. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113526

    Description: epitope description:NERTTQVPTSSNRGK antigen name:Choline binding protein A host organism:Mus musculus BALB/c

    Publication: 24807052;

  75. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113528

    Description: epitope description:NIEALQNKVADLENK antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  76. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113532

    Description: epitope description:NKVADLEKEISNLEI antigen name:UniProt:A5LSQ1 host organism:Mus musculus BALB/c

    Publication: 24807052;

  77. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113536

    Description: epitope description:NNVEDYVKEG antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  78. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113541

    Description: epitope description:PAPAPQPEKPAEEPE antigen name:UniProt:E1XNY7 host organism:Mus musculus BALB/c

    Publication: 24807052;

  79. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113562

    Description: epitope description:QREFNESPSRKKSDA antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  80. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113567

    Description: epitope description:RKADEKRQKANLAVQ antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  81. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113576

    Description: epitope description:SNGEQAEQYLAAAEK antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  82. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113580

    Description: epitope description:STLEQEVATAQHQVD antigen name:UniProt:A5LSQ1 host organism:Mus musculus BALB/c

    Publication: 24807052;

  83. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113586

    Description: epitope description:TEEKAELVRKADEKR antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  84. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113587

    Description: epitope description:TEEKARKAEEASKEI antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  85. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113590

    Description: epitope description:TLDPEGKTQDELDKE antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  86. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113593

    Description: epitope description:TQQNIDKTQKDLEDA antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  87. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113598

    Description: epitope description:VADLENKVAELDKEV antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  88. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113608

    Description: epitope description:VRAEEAPVASQSKAE antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  89. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113612

    Description: epitope description:YATLKVALAKSKVEA antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  90. A highly conserved region between amino acids 221 and 266 of dengue virus non-structural protein 1 is a major epitope region in infected patients.

    ID: 2113751

    Description: epitope description:S228, E240 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:D25-2B11C3, D25-4D3D2, D25-4D4C3

    Publication: 24778195;

  91. A highly conserved region between amino acids 221 and 266 of dengue virus non-structural protein 1 is a major epitope region in infected patients.

    ID: 2113755

    Description: epitope description:S228 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:D26-5A2B12

    Publication: 24778195;

  92. A highly conserved region between amino acids 221 and 266 of dengue virus non-structural protein 1 is a major epitope region in infected patients.

    ID: 2113769

    Description: epitope description:E240 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:D30-2B1G5

    Publication: 24778195;

  93. B-cell epitopes in GroEL of Francisella tularensis.

    ID: 2113773

    Description: epitope description:NIAEANSDYDREKLQE antigen name:60 kDa chaperonin host organism:Mus musculus BALB/c antibody name:Ab53

    Publication: 24968190;

  94. B-cell epitopes in GroEL of Francisella tularensis.

    ID: 2113774

    Description: epitope description:NIAEANSDYDREKLQE antigen name:60 kDa chaperonin host organism:Mus musculus BALB/c antibody name:Ab53

    Publication: 24968190;

  95. B-cell epitopes in GroEL of Francisella tularensis.

    ID: 2113781

    Description: epitope description:IKANIAEANSDYDREKLQERL antigen name:60 kDa chaperonin host organism:Mus musculus BALB/c antibody name:N3

    Publication: 24968190;

  96. B-cell epitopes in GroEL of Francisella tularensis.

    ID: 2113790

    Description: epitope description:NTTIIDGAGEKEAIAKRINVIK antigen name:60 kDa chaperonin host organism:Mus musculus BALB/c antibody name:Ab64

    Publication: 24968190;

  97. B-cell epitopes in GroEL of Francisella tularensis.

    ID: 2113801

    Description: epitope description:FEDEL antigen name:60 kDa chaperonin host organism:Mus musculus BALB/c antibody name:N30

    Publication: 24968190;

  98. B-cell epitopes in GroEL of Francisella tularensis.

    ID: 2113812

    Description: epitope description:CPNKSPTRC host organism:Mus musculus BALB/c antibody name:Ab53

    Publication: 24968190;

  99. Specific B-cell Epitope of Per a 1: A Major Allergen of American Cockroach (Periplaneta americana) and Anatomical Localization.

    ID: 2113818

    Description: epitope description:QDLLQNLRDKGV antigen name:Per a 1 host organism:Mus musculus BALB/c antibody name:ACR1

    Publication: 24991456;

  100. Immunization with a consensus epitope from human papillomavirus L2 induces antibodies that are broadly neutralizing.

    ID: 2113843

    Description: epitope description:LVEETSFIDAGAP antigen name:Minor capsid protein L2 host organism:Mus musculus BALB/c

    Publication: 24962748;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston