Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109436

    Description: epitope description:LCYASQMQQTKPNPK antigen name:Polymerase cofactor VP35 host organism:Homo sapiens

    Publication: 24914933;

  2. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109442

    Description: epitope description:LEKVQRQIQVHAEQG antigen name:nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  3. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109444

    Description: epitope description:LESDDEEQDRDGTSN antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  4. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109446

    Description: epitope description:LFDLDEDDEDTKPVP antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  5. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109447

    Description: epitope description:LFEVDNLTYVQLESR antigen name:Super small secreted glycoprotein host organism:Homo sapiens

    Publication: 24914933;

  6. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109453

    Description: epitope description:LGVATAHGSTLAGVN antigen name:nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  7. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109590

    Description: epitope description:NTTTEDHKIMASENS antigen name:Envelope glycoprotein host organism:Homo sapiens

    Publication: 24914933;

  8. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109598

    Description: epitope description:PDISAKDLRNIMYDH antigen name:polymerase complex protein host organism:Homo sapiens

    Publication: 24914933;

  9. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109604

    Description: epitope description:PGFGTAFHQLVQVIC antigen name:Polymerase cofactor VP35 host organism:Homo sapiens

    Publication: 24914933;

  10. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109609

    Description: epitope description:PHRTIHHASAPLTDN antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  11. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109615

    Description: epitope description:PIFQDAAPPVIHIRS antigen name:polymerase complex protein host organism:Homo sapiens

    Publication: 24914933;

  12. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109622

    Description: epitope description:PKVLMKQIPIWLPLG antigen name:Matrix protein VP40 host organism:Homo sapiens

    Publication: 24914933;

  13. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109628

    Description: epitope description:PNLHYWTTQDEGAAI antigen name:spike glycoprotein host organism:Homo sapiens

    Publication: 24914933;

  14. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109638

    Description: epitope description:PQCALIQITKRVPIF antigen name:Polymerase cofactor VP35 host organism:Homo sapiens

    Publication: 24914933;

  15. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109640

    Description: epitope description:PQDEQQDQDHTQEAR antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  16. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109652

    Description: epitope description:PSGSTSPRMLTPINE antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  17. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109654

    Description: epitope description:PSLYEESAIRGKIES antigen name:Polymerase cofactor VP35 host organism:Homo sapiens

    Publication: 24914933;

  18. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109656

    Description: epitope description:PSSGYYSTTIRYQAT antigen name:Super small secreted glycoprotein host organism:Homo sapiens

    Publication: 24914933;

  19. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109666

    Description: epitope description:PVQLPQYFTFDLTAL antigen name:Matrix protein VP40 host organism:Homo sapiens

    Publication: 24914933;

  20. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109667

    Description: epitope description:PVYRDHSEKKELPQD antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  21. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109668

    Description: epitope description:PVYRDHSEKKELPQD antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  22. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109670

    Description: epitope description:PYFGPAAEGIYIEGL antigen name:Envelope glycoprotein host organism:Homo sapiens

    Publication: 24914933;

  23. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109672

    Description: epitope description:QATGFGTNETEYLFE antigen name:Super small secreted glycoprotein host organism:Homo sapiens

    Publication: 24914933;

  24. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109689

    Description: epitope description:QKKNEISFQQTNAMV antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  25. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109690

    Description: epitope description:QKKNEISFQQTNAMV antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  26. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109691

    Description: epitope description:QLQDGKTLGLKI antigen name:polymerase complex protein host organism:Homo sapiens

    Publication: 24914933;

  27. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109693

    Description: epitope description:QLQQYAESRELDHLG antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  28. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109695

    Description: epitope description:QLVQVICKLGKDSNS antigen name:Polymerase cofactor VP35 host organism:Homo sapiens

    Publication: 24914933;

  29. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109699

    Description: epitope description:QQDQDHTQEARNQDS antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  30. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109711

    Description: epitope description:QTKPNPKTRNSQTQT antigen name:Polymerase cofactor VP35 host organism:Homo sapiens

    Publication: 24914933;

  31. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113060

    Description: epitope description:GGSWGQPHGGGWG antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  32. Identification of human neutralizing antibodies against MERS-CoV and their role in virus adaptive evolution.

    ID: 2113066

    Description: epitope description:R542 antigen name:spike glycoprotein [Human betacoronavirus 2c EMC/2012] host organism:Homo sapiens antibody name:M14D3-Fc

    Publication: 24778221;

  33. Identification of human neutralizing antibodies against MERS-CoV and their role in virus adaptive evolution.

    ID: 2113069

    Description: epitope description:P547 antigen name:spike glycoprotein [Human betacoronavirus 2c EMC/2012] host organism:Homo sapiens antibody name:1E9-Fc

    Publication: 24778221;

  34. Identification of human neutralizing antibodies against MERS-CoV and their role in virus adaptive evolution.

    ID: 2113072

    Description: epitope description:L506, T512 antigen name:spike glycoprotein [Human betacoronavirus 2c EMC/2012] host organism:Homo sapiens antibody name:3B12-Fc

    Publication: 24778221;

  35. Identification of human neutralizing antibodies against MERS-CoV and their role in virus adaptive evolution.

    ID: 2113082

    Description: epitope description:L506, Y540 antigen name:spike glycoprotein [Human betacoronavirus 2c EMC/2012] host organism:Homo sapiens antibody name:3B11-Fc

    Publication: 24778221;

  36. Polyclonal and monoclonal antibodies specific for the six-helix bundle of the human respiratory syncytial virus fusion glycoprotein as probes of the p...

    ID: 2113091

    Description: epitope description:LEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIV antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus New Zeala...

    Publication: 25010277;

  37. Polyclonal and monoclonal antibodies specific for the six-helix bundle of the human respiratory syncytial virus fusion glycoprotein as probes of the p...

    ID: 2113092

    Description: epitope description:DPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHHVNAGK antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus New Zealand Whi...

    Publication: 25010277;

  38. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113118

    Description: epitope description:NLKHVAGAAAAGA antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  39. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113126

    Description: epitope description:AAAGAVVGGLGGY antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  40. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113158

    Description: epitope description:EDRYYRENMYRYP antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  41. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113163

    Description: epitope description:ENMYRYPNQVYYR antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  42. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113164

    Description: epitope description:ENMYRYPNQVYYR antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  43. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113166

    Description: epitope description:MYRYPNQVYYRPV antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  44. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113176

    Description: epitope description:RPVDQYSNQNNFV antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  45. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113179

    Description: epitope description:QYSNQNNFVHDCV antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  46. Polyclonal and monoclonal antibodies specific for the six-helix bundle of the human respiratory syncytial virus fusion glycoprotein as probes of the p...

    ID: 2113195

    Description: epitope description:S509, L513 antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus New Zealand White antibody name:R145

    Publication: 25010277;

  47. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113198

    Description: epitope description:IKQHTVTTTTKGE antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  48. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113201

    Description: epitope description:TVTTTTKGENFTE antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  49. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113204

    Description: epitope description:TTTTKGENFTETD antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  50. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113209

    Description: epitope description:ENFTETDVKMMER antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  51. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113264

    Description: epitope description:QMCVTQYQKESQA antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  52. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113265

    Description: epitope description:QMCVTQYQKESQA antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  53. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113275

    Description: epitope description:SQAYYDGRRSSST antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  54. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113288

    Description: epitope description:LFSSPPVILLISF antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  55. Different antigenicities of the N-terminal region of cellular and scrapie prion proteins.

    ID: 2113307

    Description: epitope description:WEDRYYRE antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 24117858;

  56. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113312

    Description: epitope description:AEAKIKAATKKAELE antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  57. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113314

    Description: epitope description:AEEEAKRKADAKEQD antigen name:Choline binding protein A host organism:Mus musculus BALB/c

    Publication: 24807052;

  58. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113317

    Description: epitope description:AEKDLVAKKAELAEA antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  59. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113322

    Description: epitope description:AELEKTQKELDAALN antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  60. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113335

    Description: epitope description:AKVIPEASDLAVTKQ antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  61. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113337

    Description: epitope description:ALQNQVAELEEELSK antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  62. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113341

    Description: epitope description:APAPAPKPEKSADQQ antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  63. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113343

    Description: epitope description:APKPEQPA antigen name:UniProt:E1XNY7 host organism:Mus musculus BALB/c

    Publication: 24807052;

  64. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113345

    Description: epitope description:ARKAEEASKEIAKAT antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  65. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113356

    Description: epitope description:DAEIAKLEKDVEDFK antigen name:UniProt:E1XNY7 host organism:Mus musculus BALB/c

    Publication: 24807052;

  66. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113357

    Description: epitope description:DAENEKKIDVLQNKV antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  67. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113360

    Description: epitope description:DELDKEAEEAELDKK antigen name:UniProt:A5LSQ1 host organism:Mus musculus BALB/c

    Publication: 24807052;

  68. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113364

    Description: epitope description:DKEAAEDANIEALQN antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  69. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113366

    Description: epitope description:DKKAELATTQQNIDK antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  70. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113371

    Description: epitope description:DPDDGTEVIEAKLNK antigen name:UniProt:A5LSQ1 host organism:Mus musculus BALB/c

    Publication: 24807052;

  71. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113376

    Description: epitope description:DTAQKALDTALNELG antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  72. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113380

    Description: epitope description:EAAEAELNKKVEALQ antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  73. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113395

    Description: epitope description:EGKTQDELDKEAAED antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  74. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113404

    Description: epitope description:EKNKILEQDAENEKK antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  75. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113415

    Description: epitope description:ELELVKEEAKKPLNE antigen name:Choline binding protein A host organism:Mus musculus BALB/c

    Publication: 24807052;

  76. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113422

    Description: epitope description:ESDSEDYVK antigen name:UniProt:E1XNY7 host organism:Mus musculus BALB/c

    Publication: 24807052;

  77. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113424

    Description: epitope description:ETKKKAEEAKAEEKV antigen name:UniProt:A5LSQ1 host organism:Mus musculus BALB/c

    Publication: 24807052;

  78. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113428

    Description: epitope description:EVAPQAKI antigen name:UniProt:E1XNY7 host organism:Mus musculus BALB/c

    Publication: 24807052;

  79. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113432

    Description: epitope description:EVQQASNESQRKEAD antigen name:UniProt:A5LSQ1 host organism:Mus musculus BALB/c

    Publication: 24807052;

  80. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113439

    Description: epitope description:GKTQDELDKEAEEAE antigen name:UniProt:A5LSQ1 host organism:Mus musculus BALB/c

    Publication: 24807052;

  81. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113447

    Description: epitope description:IKAATKKAELEKAEA antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  82. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113462

    Description: epitope description:KEAEEAELDKKADEL antigen name:UniProt:A5LSQ1 host organism:Mus musculus BALB/c

    Publication: 24807052;

  83. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113470

    Description: epitope description:KKAEAKKAMDEAEKE antigen name:UniProt:E1XNY7 host organism:Mus musculus BALB/c

    Publication: 24807052;

  84. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113482

    Description: epitope description:KKVEALQNQVAELEE antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  85. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113492

    Description: epitope description:KVAEAEKKVEEAEKK antigen name:Choline binding protein A host organism:Mus musculus BALB/c

    Publication: 24807052;

  86. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113494

    Description: epitope description:KVALAKSKVEAEEAE antigen name:UniProt:A5ML49 host organism:Mus musculus BALB/c

    Publication: 24807052;

  87. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113498

    Description: epitope description:KYQQELV antigen name:UniProt:E1XNY7 host organism:Mus musculus BALB/c

    Publication: 24807052;

  88. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113500

    Description: epitope description:LATKKAELEKTQKEL antigen name:UniProt:A5LSQ1 host organism:Mus musculus BALB/c

    Publication: 24807052;

  89. Mapping of epitopes recognized by antibodies induced by immunization of mice with PspA and PspC.

    ID: 2113520

    Description: epitope description:LVAKKAELEKTEADL antigen name:UniProt:E1XNY7 host organism:Mus musculus BALB/c

    Publication: 24807052;

  90. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109713

    Description: epitope description:QTQSRPIQNVPGPHR antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  91. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109717

    Description: epitope description:QVNNLEEICQLIIQA antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  92. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109723

    Description: epitope description:REAIVNAQPKCNPNL antigen name:Envelope glycoprotein host organism:Homo sapiens

    Publication: 24914933;

  93. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109725

    Description: epitope description:RELDHLGLDDQEKKI antigen name:nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  94. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109727

    Description: epitope description:RFEVKKRDGVKRLEE antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  95. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109733

    Description: epitope description:RIPVSDIFCDIENNP antigen name:Polymerase cofactor VP35 host organism:Homo sapiens

    Publication: 24914933;

  96. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109736

    Description: epitope description:RLAKLTEAITAASLP antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;

  97. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109737

    Description: epitope description:RLGPGIPDHPLRLLR antigen name:Matrix protein VP40 host organism:Homo sapiens

    Publication: 24914933;

  98. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109738

    Description: epitope description:RLGPGIPDHPLRLLR antigen name:Matrix protein VP40 host organism:Homo sapiens

    Publication: 24914933;

  99. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109755

    Description: epitope description:RSNSTIARGGNSNTG antigen name:Matrix protein VP40 host organism:Homo sapiens

    Publication: 24914933;

  100. Identification of Continuous Human B-Cell Epitopes in the VP35, VP40, Nucleoprotein and Glycoprotein of Ebola Virus.

    ID: 2109761

    Description: epitope description:RTAKVKNEVNSFKAA antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 24914933;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston