Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Identification of serotype-specific and nonserotype-specific B-cell epitopes of coxsackie B virus using synthetic peptides.

    ID: 1482297

    Description: epitope description:RHVNAGSTGPIKSTI antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7513917;

  2. Neutralizing epitopes of type O foot-and-mouth disease virus. II. Mapping three conformational sites with synthetic peptide reagents.

    ID: 1482306

    Description: epitope description:N143, L144, R145, G146, R200, H201, K202, Q203, K204, I205, V206, A207, P208, V209, K210, Q211, T212, L213 antigen name:Genome po...

    Publication: 2471812;

  3. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482314

    Description: epitope description:YSRNAVPNLRGDLQVLAQKVARTLPTSFNY antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;

  4. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482317

    Description: epitope description:YSRNAVPNLRGDLQVLAQKVARTLPTSFNY antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;

  5. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482318

    Description: epitope description:YSRNAVPNLRGDLQVLAQKVARTLPTSFNY antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;

  6. Identification of serotype-specific and nonserotype-specific B-cell epitopes of coxsackie B virus using synthetic peptides.

    ID: 1482348

    Description: epitope description:IKSTIRIYFKPKHVK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7513917;

  7. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482353

    Description: epitope description:TAYTASARRGDLAHLAAAHARHLPTSFNF antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;

  8. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482355

    Description: epitope description:TAYTASARRGDLAHLAAAHARHLPTSFNF antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;

  9. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482357

    Description: epitope description:TAYTASARRGDLAHLAAAHARHLPTSFNF antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;

  10. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482360

    Description: epitope description:YKPTGTAPRENIRGDLATLAARIASETHIPTTFNY antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:ant...

    Publication: 2155177;

  11. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482364

    Description: epitope description:YKPTGTAPRENIRGDLATLAARIASETHIPTTFNY antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:ant...

    Publication: 2155177;

  12. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482377

    Description: epitope description:YGEEPTMRGDRAVLASKVNKQLPTSFNY antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-pepti...

    Publication: 2155177;

  13. Identification of serotype-specific and nonserotype-specific B-cell epitopes of coxsackie B virus using synthetic peptides.

    ID: 1482387

    Description: epitope description:GPTEESVERAMGRVA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7513917;

  14. Identification of serotype-specific and nonserotype-specific B-cell epitopes of coxsackie B virus using synthetic peptides.

    ID: 1482394

    Description: epitope description:IKSTIRIYFKPKHVK antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis

    Publication: 7513917;

  15. Identification of serotype-specific and nonserotype-specific B-cell epitopes of coxsackie B virus using synthetic peptides.

    ID: 1482401

    Description: epitope description:GPSNSEQIPALTAVE antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis

    Publication: 7513917;

  16. Linear antigenic and immunogenic regions of the respiratory syncytial virus P protein.

    ID: 1482412

    Description: epitope description:PTPSDNPFSKLYKETIETFD antigen name:Phosphoprotein host organism:Mus musculus antibody name:RS203

    Publication: 8207401;

  17. Linear antigenic and immunogenic regions of the respiratory syncytial virus P protein.

    ID: 1482414

    Description: epitope description:PTPSDNPFSKLYKETIETFD antigen name:Phosphoprotein host organism:Homo sapiens

    Publication: 8207401;

  18. Linear antigenic and immunogenic regions of the respiratory syncytial virus P protein.

    ID: 1482418

    Description: epitope description:EKLNNLLEGNDSDNDLSLEDF antigen name:Phosphoprotein host organism:Homo sapiens

    Publication: 8207401;

  19. Failure to detect evidence of human T-lymphotropic virus (HTLV) type I and type II in blood donors with isolated gag antibodies to HTLV-I/II.

    ID: 1482441

    Description: epitope description:PPSSPTHDPPDSDPQI antigen name:Gag-Pro-Pol polyprotein host organism:Homo sapiens

    Publication: 1627806;

  20. Location of neutralizing epitopes defined by monoclonal antibodies generated against the outer capsid polypeptide, VP1, of foot-and-mouth disease viru...

    ID: 1482478

    Description: epitope description:GDFGSLAPRVARQLPASFNYGAIK antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:6HE4, 7SF3

    Publication: 6085200;

  21. Location of neutralizing epitopes defined by monoclonal antibodies generated against the outer capsid polypeptide, VP1, of foot-and-mouth disease viru...

    ID: 1482481

    Description: epitope description:GDFGSLAPRVARQLPASFNYGAIK antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:6HE4, 7SF3

    Publication: 6085200;

  22. Binding of neutralizing monoclonal antibodies to regions of the fusion protein of respiratory syncytial virus expressed in Escherichia coli.

    ID: 1482488

    Description: epitope description:PITNDQKK antigen name:Fusion glycoprotein F0 host organism:Mus musculus antibody name:RS348

    Publication: 7506297;

  23. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482491

    Description: epitope description:GSGVRGDFG antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 10501234;

  24. Influence of the C terminus of the small protein subunit of bean pod mottle virus on the antigenicity of the virus determined using monoclonal antibod...

    ID: 1482495

    Description: epitope description:AFSVPQANARSSENAESSA antigen name:RNA2 polyprotein host organism:Oryctolagus cuniculus antibody name:anti-180-198

    Publication: 1716655;

  25. Influence of the C terminus of the small protein subunit of bean pod mottle virus on the antigenicity of the virus determined using monoclonal antibod...

    ID: 1482499

    Description: epitope description:ANARSSENAESSA antigen name:RNA2 polyprotein host organism:Oryctolagus cuniculus antibody name:anti-186-198

    Publication: 1716655;

  26. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482502

    Description: epitope description:DFGSLAPRVA antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 10501234;

  27. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482510

    Description: epitope description:DFGSLAPRVA antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 10501234;

  28. Priming for and induction of anti-poliovirus neutralizing antibodies by synthetic peptides.

    ID: 1482513

    Description: epitope description:STTNKDK antigen name:Genome polyprotein host organism:Mus musculus antibody name:1 BM 55-6

    Publication: 6310403;

  29. Characterization of HTLV envelope seroreactivity in large granular lymphocyte leukemia.

    ID: 1482520

    Description: epitope description:QEQCRFPNITNSHVSILQERPPLENRVLTGWGLN antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 15725471;

  30. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482531

    Description: epitope description:NLRGDLQVLA antigen name:Polyprotein host organism:Cavia porcellus

    Publication: 10501234;

  31. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482539

    Description: epitope description:DLQVLAQKVA antigen name:Polyprotein host organism:Cavia porcellus

    Publication: 10501234;

  32. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482544

    Description: epitope description:VLAQKVARTL antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 10501234;

  33. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482558

    Description: epitope description:PNLRGDLQVL antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 10501234;

  34. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482559

    Description: epitope description:NLRGDLQVLA antigen name:Polyprotein host organism:Cavia porcellus

    Publication: 10501234;

  35. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482560

    Description: epitope description:NLRGDLQVLA antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 10501234;

  36. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482564

    Description: epitope description:RGDLQVLAQK antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 10501234;

  37. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482565

    Description: epitope description:RDALPNTEASGPTHSKE antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2983321;

  38. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482572

    Description: epitope description:RYNRNAVPNL antigen name:Polyprotein host organism:Cavia porcellus

    Publication: 10501234;

  39. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482573

    Description: epitope description:RDALPNTEASGPTHSKE antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2983321;

  40. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482577

    Description: epitope description:DLQVLAQKVA antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 10501234;

  41. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482587

    Description: epitope description:VRGDFGSLAP antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 10501234;

  42. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482590

    Description: epitope description:GDFGSLAPRV antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 10501234;

  43. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482593

    Description: epitope description:DFGSLAPRVA antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 10501234;

  44. Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

    ID: 1482595

    Description: epitope description:FGSLAPRVAR antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 10501234;

  45. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482613

    Description: epitope description:PPGAPVPEKWDDYTWQTSSNP antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2983321;

  46. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482614

    Description: epitope description:SIFYTYGTAPARISVPYVGI antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2983321;

  47. Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

    ID: 1482621

    Description: epitope description:VVNDHNPTKVTSKIRVYLKPK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2983321;

  48. A soybean G2 glycinin allergen. 2. Epitope mapping and three-dimensional modeling.

    ID: 1475634

    Description: epitope description:PSTYQEPQESQQRGR antigen name:Glycinin G2 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 11112857;

  49. A soybean G2 glycinin allergen. 2. Epitope mapping and three-dimensional modeling.

    ID: 1475636

    Description: epitope description:QRPQDRHQKVHRFRE antigen name:Glycinin G2 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 11112857;

  50. A soybean G2 glycinin allergen. 2. Epitope mapping and three-dimensional modeling.

    ID: 1475639

    Description: epitope description:AWWMYNNEDTPVVAV antigen name:Glycinin G2 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 11112857;

  51. A soybean G2 glycinin allergen. 2. Epitope mapping and three-dimensional modeling.

    ID: 1475641

    Description: epitope description:IIDTNSLENQLDQMP antigen name:Glycinin G2 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 11112857;

  52. A soybean G2 glycinin allergen. 2. Epitope mapping and three-dimensional modeling.

    ID: 1475653

    Description: epitope description:GGLRVTAPAMRKPQQ antigen name:Glycinin G2 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 11112857;

  53. A soybean G2 glycinin allergen. 2. Epitope mapping and three-dimensional modeling.

    ID: 1475654

    Description: epitope description:AMRKPQQEEDDDDEE antigen name:Glycinin G2 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 11112857;

  54. A soybean G2 glycinin allergen. 2. Epitope mapping and three-dimensional modeling.

    ID: 1475668

    Description: epitope description:GRALVQVVNCNGERV antigen name:Glycinin G2 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 11112857;

  55. A soybean G2 glycinin allergen. 2. Epitope mapping and three-dimensional modeling.

    ID: 1475669

    Description: epitope description:NCNGERVFDGELQEG antigen name:Glycinin G2 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 11112857;

  56. A soybean G2 glycinin allergen. 2. Epitope mapping and three-dimensional modeling.

    ID: 1475679

    Description: epitope description:KNNNPFSFLVPPQES antigen name:Glycinin G2 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 11112857;

  57. A soybean G2 glycinin allergen. 2. Epitope mapping and three-dimensional modeling.

    ID: 1475680

    Description: epitope description:LVPPQESQRRAVA antigen name:Glycinin G2 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 11112857;

  58. Specific histamine release capacity of peptides selected from the modelized Der p I protein, a major allergen of Dermatophagoides pteronyssinus.

    ID: 1475698

    Description: epitope description:CQIYPPNANKIREALAQ antigen name:Der p 1 host organism:Homo sapiens

    Publication: 1376413;

  59. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475704

    Description: epitope description:NDDASVDFVAEPVK antigen name:Cardiovirus B protein host organism:Mus musculus SJL antibody name:Anti-TMEV mouse sera

    Publication: 7512162;

  60. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475709

    Description: epitope description:NDDASVDFVAEPVK antigen name:Cardiovirus B protein host organism:Mus musculus C57BL/6 antibody name:Anti-TMEV mouse sera

    Publication: 7512162;

  61. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475712

    Description: epitope description:TKINADNPVPILELE antigen name:Cardiovirus B protein host organism:Mus musculus C57BL/6 antibody name:Anti-TMEV mouse sera

    Publication: 7512162;

  62. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475717

    Description: epitope description:QNTEEMENLSDRVAS antigen name:Cardiovirus B protein host organism:Mus musculus BALB/c antibody name:Anti-TMEV mouse sera

    Publication: 7512162;

  63. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1475722

    Description: epitope description:TRDVEERVHVMRKTK antigen name:Polyprotein host organism:Sus scrofa antibody name:pig serum

    Publication: 17320098;

  64. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1475729

    Description: epitope description:LNEGVVLDEVIFSKH antigen name:Polyprotein host organism:Sus scrofa antibody name:pig serum

    Publication: 17320098;

  65. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1475736

    Description: epitope description:YASRLHSVLGTANAP antigen name:Polyprotein host organism:Sus scrofa antibody name:pig serum

    Publication: 17320098;

  66. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1475744

    Description: epitope description:WALQGKRRGALIDFE antigen name:Polyprotein host organism:Sus scrofa antibody name:pig serum

    Publication: 17320098;

  67. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1475748

    Description: epitope description:PEVEAALKLMEKREY antigen name:Polyprotein host organism:Sus scrofa antibody name:pig serum

    Publication: 17320098;

  68. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1475759

    Description: epitope description:IGRFCAQMHSNNGPQ antigen name:Polyprotein host organism:Sus scrofa antibody name:pig serum

    Publication: 17320098;

  69. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1475765

    Description: epitope description:FGTHFAQYRNVWDVD antigen name:Polyprotein host organism:Sus scrofa antibody name:pig serum

    Publication: 17320098;

  70. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1475793

    Description: epitope description:PADKSDKGFVLGHSI antigen name:Polyprotein host organism:Sus scrofa antibody name:pig serum

    Publication: 17320098;

  71. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1475801

    Description: epitope description:KTLEAILSFARRGTI antigen name:Polyprotein host organism:Sus scrofa antibody name:pig serum

    Publication: 17320098;

  72. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1475804

    Description: epitope description:QEKLISVAGLAVHSG antigen name:Polyprotein host organism:Sus scrofa antibody name:pig serum

    Publication: 17320098;

  73. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1475805

    Description: epitope description:SVAGLAVHSGPDEYR antigen name:Polyprotein host organism:Sus scrofa antibody name:pig serum

    Publication: 17320098;

  74. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1475807

    Description: epitope description:PDEYRRLFEPFQGLF antigen name:Polyprotein host organism:Sus scrofa antibody name:pig serum

    Publication: 17320098;

  75. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475813

    Description: epitope description:TGYRYDSRTGFFATN antigen name:Cardiovirus B protein host organism:Mus musculus C57BL/6 antibody name:Anti-TMEV mouse sera

    Publication: 7512162;

  76. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475816

    Description: epitope description:TGYRYDSRTGFFATN antigen name:Cardiovirus B protein host organism:Mus musculus SJL antibody name:Anti-TMEV mouse sera

    Publication: 7512162;

  77. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475818

    Description: epitope description:PIYGKTISTPSDYM antigen name:Cardiovirus B protein host organism:Mus musculus BALB/c antibody name:Anti-TMEV mouse sera

    Publication: 7512162;

  78. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475822

    Description: epitope description:NDDASVDFVAEPVK antigen name:Cardiovirus B protein host organism:Mus musculus SJL antibody name:Mouse cerebrospinal fluid Ab

    Publication: 7512162;

  79. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475823

    Description: epitope description:NDDASVDFVAEPVK antigen name:Cardiovirus B protein host organism:Mus musculus BALB/c antibody name:Mouse cerebrospinal fluid Ab

    Publication: 7512162;

  80. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475824

    Description: epitope description:NDDASVDFVAEPVK antigen name:Cardiovirus B protein host organism:Mus musculus SJL antibody name:Mouse cerebrospinal fluid Ab

    Publication: 7512162;

  81. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475832

    Description: epitope description:RWAPTGAPADVTDQL antigen name:Cardiovirus B protein host organism:Mus musculus SJL antibody name:Mouse cerebrospinal fluid Ab

    Publication: 7512162;

  82. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475833

    Description: epitope description:QNTEEMENLSDRVAS antigen name:Cardiovirus B protein host organism:Mus musculus C57BL/6 antibody name:Mouse cerebrospinal fluid Ab

    Publication: 7512162;

  83. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475836

    Description: epitope description:QNTEEMENLSDRVAS antigen name:Cardiovirus B protein host organism:Mus musculus SJL antibody name:Mouse cerebrospinal fluid Ab

    Publication: 7512162;

  84. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475844

    Description: epitope description:PIYGKTISTPSDYM antigen name:Cardiovirus B protein host organism:Mus musculus SJL antibody name:Mouse cerebrospinal fluid Ab

    Publication: 7512162;

  85. Molecular basis of IgE-recognition of Lol p 5, a major allergen of rye-grass pollen.

    ID: 1475846

    Description: epitope description:AAATPATPAATPA antigen name:Other Lolium perenne (perennial ryegrass) protein host organism:Homo sapiens

    Publication: 9747889;

  86. Molecular basis of IgE-recognition of Lol p 5, a major allergen of rye-grass pollen.

    ID: 1475857

    Description: epitope description:AKYDAFVTALTE antigen name:Other Lolium perenne (perennial ryegrass) protein host organism:Homo sapiens

    Publication: 9747889;

  87. Molecular basis of IgE-recognition of Lol p 5, a major allergen of rye-grass pollen.

    ID: 1475858

    Description: epitope description:ALTEALRVIAGA antigen name:Other Lolium perenne (perennial ryegrass) protein host organism:Homo sapiens

    Publication: 9747889;

  88. Molecular basis of IgE-recognition of Lol p 5, a major allergen of rye-grass pollen.

    ID: 1475867

    Description: epitope description:EVKYAVFEAALT antigen name:Other Lolium perenne (perennial ryegrass) protein host organism:Homo sapiens

    Publication: 9747889;

  89. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475874

    Description: epitope description:NDDASVDFVAEPVK antigen name:Cardiovirus B protein host organism:Mus musculus C57BL/6 antibody name:Mouse anti-peptide sera

    Publication: 7512162;

  90. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475876

    Description: epitope description:RWAPTGAPADVTDQL antigen name:Cardiovirus B protein host organism:Mus musculus C57BL/6 antibody name:Mouse anti-peptide sera

    Publication: 7512162;

  91. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475879

    Description: epitope description:QNTEEMENLSDRVAS antigen name:Cardiovirus B protein host organism:Mus musculus C57BL/6 antibody name:Mouse anti-peptide sera

    Publication: 7512162;

  92. Analysis of antibody responses to predominant linear epitopes of Theiler's murine encephalomyelitis virus.

    ID: 1475884

    Description: epitope description:PIYGKTISTPSDYM antigen name:Cardiovirus B protein host organism:Mus musculus C57BL/6 antibody name:Mouse anti-peptide sera

    Publication: 7512162;

  93. Identification and analysis of a conserved immunoglobulin E-binding epitope in soybean G1a and G2a and peanut Ara h 3 glycinins.

    ID: 1475887

    Description: epitope description:NEGSNILSGFAPEFL antigen name:Glycinin G2 host organism:Homo sapiens

    Publication: 12485602;

  94. Identification and analysis of a conserved immunoglobulin E-binding epitope in soybean G1a and G2a and peanut Ara h 3 glycinins.

    ID: 1475889

    Description: epitope description:LKEAFGVNMQIVRNL antigen name:Glycinin G2 host organism:Homo sapiens

    Publication: 12485602;

  95. Identification and analysis of a conserved immunoglobulin E-binding epitope in soybean G1a and G2a and peanut Ara h 3 glycinins.

    ID: 1475894

    Description: epitope description:VTAPAMRKPQQEEDD antigen name:Glycinin G2 host organism:Homo sapiens

    Publication: 12485602;

  96. Identification and analysis of a conserved immunoglobulin E-binding epitope in soybean G1a and G2a and peanut Ara h 3 glycinins.

    ID: 1475899

    Description: epitope description:SGFTPEFLEQAFQVD antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 12485602;

  97. Characterization of Trichomonas vaginalis AP33 adhesin and cell surface interactive domains.

    ID: 1475916

    Description: epitope description:SEEDAAEWI antigen name:Other Trichomonas vaginalis protein host organism:Mus musculus antibody name:AP33 mAb

    Publication: 9846736;

  98. Molecular cloning and epitope analysis of the peanut allergen Ara h 3.

    ID: 1475921

    Description: epitope description:ALSRLVLRRNALRRP antigen name:Ara h 3 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 10021462;

  99. Molecular cloning and epitope analysis of the peanut allergen Ara h 3.

    ID: 1475944

    Description: epitope description:EFLRYQQQSRQSRRR antigen name:Ara h 3 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 10021462;

  100. Molecular cloning and epitope analysis of the peanut allergen Ara h 3.

    ID: 1475951

    Description: epitope description:NIFSGFTPEFLEQAF antigen name:Ara h 3 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 10021462;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston