Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Development of recombinant diagnostic reagents based on pp85(U14) and p86(U11) proteins to detect the human immune response to human herpesvirus 7 inf...

    ID: 1379034

    Description: epitope description:SRPGSTTPSGNSARYGNNT antigen name:U14 protein host organism:Mus musculus BALB/c antibody name:MAb 5E1

    Publication: 10565918;

  2. Mapping of the epitopes of Epstein-Barr virus gp350 using monoclonal antibodies and recombinant proteins expressed in Escherichia coli defines three a...

    ID: 1379106

    Description: epitope description:PASQDMPTNTTDITYV antigen name:Envelope glycoprotein GP350 host organism:Mus musculus antibody name:BMA-17

    Publication: 1719128;

  3. Characterization of monoclonal antibodies recognizing amino- and carboxy-terminal epitopes of the herpes simplex virus UL42 protein.

    ID: 1379120

    Description: epitope description:MTDSPGGVAP antigen name:DNA polymerase processivity factor host organism:Mus musculus BALB/c antibody name:13

    Publication: 8578868;

  4. Characterization of monoclonal antibodies recognizing amino- and carboxy-terminal epitopes of the herpes simplex virus UL42 protein.

    ID: 1379122

    Description: epitope description:GDRGILIHNTIFGEQVFLPLEHSQFSRYRWRGPTAAFLSLVDQKRSL antigen name:DNA polymerase processivity factor host organism:Mus musculus BALB/c ...

    Publication: 8578868;

  5. Characterization of monoclonal antibodies recognizing amino- and carboxy-terminal epitopes of the herpes simplex virus UL42 protein.

    ID: 1379124

    Description: epitope description:GDRGILIHNTIFGEQVFLPLEHSQFSRYRWRGPTAAFLSLVDQKRSL antigen name:DNA polymerase processivity factor host organism:Mus musculus BALB/c ...

    Publication: 8578868;

  6. HSP 90, yeasts and Corynebacterium jeikeium.

    ID: 1379146

    Description: epitope description:STDEPAGESA antigen name:Heat shock protein 90 homolog host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1718769;

  7. Characterization of the antigenic determinants of the Leishmania infantum histone H3 recognized by antibodies elicited during canine visceral leishman...

    ID: 1379176

    Description: epitope description:MSRTKETARAKRTITSKKSK antigen name:Putative histone H3 host organism:Canis lupus familiaris

    Publication: 8973612;

  8. Characterization of the antigenic determinants of the Leishmania infantum histone H3 recognized by antibodies elicited during canine visceral leishman...

    ID: 1379177

    Description: epitope description:KRTITSKKSKKAPSGASGVK antigen name:Histone H3 host organism:Canis lupus familiaris

    Publication: 8973612;

  9. Characterization of the antigenic determinants of the Leishmania infantum histone H3 recognized by antibodies elicited during canine visceral leishman...

    ID: 1379179

    Description: epitope description:RSHRRWRPGTCAIREIRKFQ antigen name:Histone H3 host organism:Canis lupus familiaris

    Publication: 8973612;

  10. Characterization of the antigenic determinants of the Leishmania infantum histone H3 recognized by antibodies elicited during canine visceral leishman...

    ID: 1379186

    Description: epitope description:TNLACIHAKRVTIQPKDIQL antigen name:Histone H3 host organism:Canis lupus familiaris

    Publication: 8973612;

  11. Synthetic peptides to identify antigenic determinants on Epstein-Barr virus gp350/220.

    ID: 1379189

    Description: epitope description:TGEDPGFFNV antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1703134;

  12. Synthetic peptides to identify antigenic determinants on Epstein-Barr virus gp350/220.

    ID: 1379190

    Description: epitope description:TGEDPGFFNV antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1703134;

  13. Synthetic peptides to identify antigenic determinants on Epstein-Barr virus gp350/220.

    ID: 1379191

    Description: epitope description:STTPRPRYNA antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1703134;

  14. The influence of branched polypeptide carriers on the immunogenicity of predicted epitopes of HSV-1 glycoprotein D.

    ID: 1379204

    Description: epitope description:SALLEDPVG antigen name:Envelope glycoprotein D host organism:Mus musculus

    Publication: 7527933;

  15. Locations of herpes simplex virus type 2 glycoprotein B epitopes recognized by human serum immunoglobulin G antibodies.

    ID: 1379207

    Description: epitope description:SAAPAAPAAPRASGGVAATVAANG antigen name:Envelope glycoprotein B host organism:Homo sapiens

    Publication: 8627770;

  16. Mycobacterial 65,000 MW heat-shock protein shares a carboxy-terminal epitope with human epidermal cytokeratin 1/2.

    ID: 1379222

    Description: epitope description:EKASVPGGGDMGGMDF antigen name:60 kDa chaperonin 2 host organism:Mus musculus BALB/c antibody name:Ne5 and Nd4

    Publication: 1385316;

  17. Identification of a novel B-cell epitope of restricted specificity on the hsp 65-kDa protein of Mycobacterium tuberculosis.

    ID: 1379232

    Description: epitope description:EKASVPGGGDMGGMDF antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Mus musculus BALB/c antibody name:Ne5 and Nd4

    Publication: 1711877;

  18. Identification of a novel B-cell epitope of restricted specificity on the hsp 65-kDa protein of Mycobacterium tuberculosis.

    ID: 1379234

    Description: epitope description:EKASVPGGGDMGGMDF antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Mus musculus BALB/c antibody name:Ne5

    Publication: 1711877;

  19. Identification of a novel B-cell epitope of restricted specificity on the hsp 65-kDa protein of Mycobacterium tuberculosis.

    ID: 1379235

    Description: epitope description:EKASVPGGGDMGGMDF antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Mus musculus BALB/c antibody name:Ne5

    Publication: 1711877;

  20. Identification of a novel B-cell epitope of restricted specificity on the hsp 65-kDa protein of Mycobacterium tuberculosis.

    ID: 1379237

    Description: epitope description:EKASVPGGGDMGGMDF antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Mus musculus BALB/c antibody name:Ne5

    Publication: 1711877;

  21. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379385

    Description: epitope description:GPSSFSSR antigen name:Leishmania aethiopica protein host organism:Homo sapiens

    Publication: 9229379;

  22. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379387

    Description: epitope description:AETLPIIT antigen name:Leishmania aethiopica protein host organism:Homo sapiens

    Publication: 9229379;

  23. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379388

    Description: epitope description:PIITSSES antigen name:Leishmania aethiopica protein host organism:Homo sapiens

    Publication: 9229379;

  24. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379392

    Description: epitope description:SIDKIGGG antigen name:Leishmania aethiopica protein host organism:Homo sapiens

    Publication: 9229379;

  25. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379401

    Description: epitope description:CHNAETAG antigen name:Leishmania aethiopica protein host organism:Homo sapiens

    Publication: 9229379;

  26. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379404

    Description: epitope description:GDVRGARL antigen name:Leishmania aethiopica protein host organism:Homo sapiens

    Publication: 9229379;

  27. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379407

    Description: epitope description:GIIPTNDV antigen name:Other Leishmania infantum protein host organism:Homo sapiens

    Publication: 9229379;

  28. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379412

    Description: epitope description:ASGSSEHM antigen name:Other Leishmania infantum protein host organism:Homo sapiens

    Publication: 9229379;

  29. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379415

    Description: epitope description:HLPRVPIG antigen name:Leishmania aethiopica protein host organism:Homo sapiens

    Publication: 9229379;

  30. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379419

    Description: epitope description:ISPPLFSC antigen name:Leishmania aethiopica protein host organism:Homo sapiens

    Publication: 9229379;

  31. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380336

    Description: epitope description:QWFLDL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  32. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380346

    Description: epitope description:LPGADT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  33. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380351

    Description: epitope description:TQGSNW antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  34. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380354

    Description: epitope description:SNWIQK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  35. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380356

    Description: epitope description:WIQKET antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  36. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380362

    Description: epitope description:LVTFKN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  37. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380363

    Description: epitope description:VTFKNP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  38. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380365

    Description: epitope description:FKNPHA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  39. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380366

    Description: epitope description:KNPHAK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  40. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380369

    Description: epitope description:HAKKQD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  41. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380374

    Description: epitope description:DVVVLG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  42. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380381

    Description: epitope description:QEGAMH antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  43. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380384

    Description: epitope description:AMHTAL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  44. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380388

    Description: epitope description:ALTGAT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  45. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380401

    Description: epitope description:NLLFTG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  46. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380402

    Description: epitope description:LLFTGH antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  47. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380411

    Description: epitope description:RLRMDK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  48. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380413

    Description: epitope description:RMDKLQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  49. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380416

    Description: epitope description:KLQLKG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  50. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380435

    Description: epitope description:EIAETQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston