Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548602

    Description: epitope description:VDNQKQQHGALRNQGSRFHIKATHNFGD antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:anti-P2

    Publication: 8500904;

  2. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548603

    Description: epitope description:FGDITSKYAYVTLGNKAFGEVKLGRAKT antigen name:Outer membrane protein P2 host organism:Mus musculus C3H antibody name:anti-P2

    Publication: 8500904;

  3. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548606

    Description: epitope description:GRAKTIADGITSAEDKEYGVLNNSDYIP antigen name:Outer membrane protein P2 host organism:Mus musculus C57BL/6 antibody name:anti-P2

    Publication: 8500904;

  4. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548608

    Description: epitope description:SDYIPTSGNTVGYTFKGIDGLVLGAN antigen name:Outer membrane protein P2 host organism:Mus musculus C57BL/6 antibody name:anti-P2

    Publication: 8500904;

  5. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548609

    Description: epitope description:AGEVRIGEINNGIQVGAKYDANDIVA antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:anti-P2

    Publication: 8500904;

  6. Identification of linear B-cell determinants of pertussis toxin associated with the receptor recognition site of the S3 subunit.

    ID: 1548741

    Description: epitope description:TQQGGAYGRCPNGTRA antigen name:Pertussis toxin subunit 3 host organism:Oryctolagus cuniculus Chinchilla Bastard

    Publication: 1706321;

  7. Identification of linear B-cell determinants of pertussis toxin associated with the receptor recognition site of the S3 subunit.

    ID: 1548756

    Description: epitope description:GQPAADHYYSKVT antigen name:Pertussis toxin subunit 3 host organism:Oryctolagus cuniculus Chinchilla Bastard

    Publication: 1706321;

  8. Immunological detection of penicillin-binding protein 2' of methicillin-resistant staphylococci by using monoclonal antibodies prepared from synthetic...

    ID: 1548765

    Description: epitope description:YNKLTEDKKEPLLNKFQITTSPGSTQKILTA antigen name:UniProt:A7WWU8 host organism:Mus musculus BALB/c

    Publication: 7494059;

  9. Immunological detection of penicillin-binding protein 2' of methicillin-resistant staphylococci by using monoclonal antibodies prepared from synthetic...

    ID: 1548766

    Description: epitope description:IGLNNKTLDDKTSYKIDGKGWQKDKSWGGY antigen name:UniProt:A7WWU8 host organism:Mus musculus BALB/c

    Publication: 7494059;

  10. Epitope-specific protective immunogenicity of chemically synthesized 13-, 18-, and 23-residue peptide fragments of streptococcal M protein.

    ID: 1548767

    Description: epitope description:RKADLEKALEGAM antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6425829;

  11. Epitope-specific protective immunogenicity of chemically synthesized 13-, 18-, and 23-residue peptide fragments of streptococcal M protein.

    ID: 1548768

    Description: epitope description:RKADLEKALEGAM antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6425829;

  12. Epitope-specific protective immunogenicity of chemically synthesized 13-, 18-, and 23-residue peptide fragments of streptococcal M protein.

    ID: 1548774

    Description: epitope description:RKADLEKALEGAM antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6425829;

  13. Epitope-specific protective immunogenicity of chemically synthesized 13-, 18-, and 23-residue peptide fragments of streptococcal M protein.

    ID: 1548778

    Description: epitope description:LEAEKAALAARKADLEKALEGAM antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6425829;

  14. Improved mimicry of a foot-and-mouth disease virus antigenic site by a viral peptide displayed on beta-galactosidase surface.

    ID: 1548789

    Description: epitope description:YTASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Mus musculus antibody name:SB10, SD6

    Publication: 9634810;

  15. Improved mimicry of a foot-and-mouth disease virus antigenic site by a viral peptide displayed on beta-galactosidase surface.

    ID: 1548791

    Description: epitope description:YTASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Mus musculus antibody name:7FC12, 7CA8, 7JD1

    Publication: 9634810;

  16. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548807

    Description: epitope description:VDNQKQQHGALRNQGSRFHIKATHNFGD antigen name:Outer membrane protein P2 host organism:Cavia porcellus antibody name:anti-P2

    Publication: 8500904;

  17. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548814

    Description: epitope description:DIVAKIAYGRTNYKYNESDEHKQQLNG antigen name:Outer membrane protein P2 host organism:Cavia porcellus antibody name:anti-P2

    Publication: 8500904;

  18. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548827

    Description: epitope description:LSIIAEQSNSTVDNQK antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus antibody name:anti-P2

    Publication: 8500904;

  19. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548840

    Description: epitope description:FGDITSKYAYVTLGNKAFGEVKLGRAKT antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus antibody name:anti-P2

    Publication: 8500904;

  20. Different B-cell responses to human T-cell lymphotropic virus type I (HTLV-I) envelope synthetic peptides in HTLV-I-infected individuals.

    ID: 1548844

    Description: epitope description:DISQLTQAIVKNHKNLLK antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1890164;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston