Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Sequences of antigenic epitopes of streptokinase identified via random peptide libraries displayed on phage.

    ID: 1509207

    Description: epitope description:PFWLSD host organism:Mus musculus BALB/c antibody name:9D10

    Publication: 9268662;

  2. Sequences of antigenic epitopes of streptokinase identified via random peptide libraries displayed on phage.

    ID: 1509209

    Description: epitope description:QKSKPF host organism:Mus musculus BALB/c antibody name:10E1

    Publication: 9268662;

  3. Use of immunoreactive synthetic HTLV-1 peptides in the search for antibody reactivity in multiple sclerosis.

    ID: 1509223

    Description: epitope description:LPPTAPPLLPHSNLDHILEPSIPW antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1546533;

  4. Importance of an immunodominant surface-exposed loop on outer membrane protein P2 of nontypeable Haemophilus influenzae.

    ID: 1509259

    Description: epitope description:EQSSSTEDNQEQQHGALRNQGS antigen name:Other Haemophilus influenzae protein host organism:Oryctolagus cuniculus

    Publication: 8975905;

  5. Importance of an immunodominant surface-exposed loop on outer membrane protein P2 of nontypeable Haemophilus influenzae.

    ID: 1509263

    Description: epitope description:QERDLRTLDSRTNPTKSGEVT antigen name:Other Haemophilus influenzae protein host organism:Oryctolagus cuniculus

    Publication: 8975905;

  6. Importance of an immunodominant surface-exposed loop on outer membrane protein P2 of nontypeable Haemophilus influenzae.

    ID: 1509274

    Description: epitope description:EDKEYGLLNSKKYIPTNGN antigen name:Other Haemophilus influenzae protein host organism:Mus musculus

    Publication: 8975905;

  7. Importance of an immunodominant surface-exposed loop on outer membrane protein P2 of nontypeable Haemophilus influenzae.

    ID: 1509285

    Description: epitope description:TNYKDSNHSYTQKIPKANAADADTDTTIIYPHHGKKQEVNGALASL antigen name:Other Haemophilus influenzae protein host organism:Oryctolagus cunicul...

    Publication: 8975905;

  8. Scrapie-associated precursor proteins: antigenic relationship between species and immunocytochemical localization in normal, scrapie, and Creutzfeldt-...

    ID: 1509294

    Description: epitope description:GQGGGTHNQWNKPSK antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Oryctolagus cuniculus New Zealand ...

    Publication: 1969126;

  9. Scrapie-associated precursor proteins: antigenic relationship between species and immunocytochemical localization in normal, scrapie, and Creutzfeldt-...

    ID: 1509296

    Description: epitope description:GQGGGTHNQWNKPSK antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Oryctolagus cuniculus New Zealand ...

    Publication: 1969126;

  10. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509299

    Description: epitope description:KTKRNTNRRPQDVKF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  11. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509301

    Description: epitope description:GPRLGVRATRKTSERSQP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  12. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509302

    Description: epitope description:ATRKTSERSQPRGRRQPI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  13. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509310

    Description: epitope description:YPGHVSGHRMAWDMM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  14. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509314

    Description: epitope description:AADMIMHTPGCVPCV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  15. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509315

    Description: epitope description:SRCWVALTPTLAARN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  16. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509316

    Description: epitope description:AARNSSIPTTTIRRHVDL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  17. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509318

    Description: epitope description:SPRRYETVQDCNCSLYPG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  18. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509322

    Description: epitope description:NETDVLLLNNTRPPQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  19. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509323

    Description: epitope description:DCFRKHPEATYTKCGSGP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  20. Fine molecular analysis of the antigenicity of the Androctonus australis hector scorpion neurotoxin II: a new antigenic epitope disclosed by the Pepsc...

    ID: 1509337

    Description: epitope description:NCTYFCG antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 7690110;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston