Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Immunohistochemical detection of Influenza virus infection in formalin-fixed tissues with anti-H5 monoclonal antibody recognizing FFWTILKP.

    ID: 1598434

    Description: epitope description:FFWTILKP antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:7H10

    Publication: 18930768;

  2. Matrix protein 2 vaccination and protection against influenza viruses, including subtype H5N1.

    ID: 1598497

    Description: epitope description:MSLLTEVETPIRNEWGCRCNDSSD antigen name:Matrix protein 2 host organism:Mus musculus Nude

    Publication: 17552096;

  3. Immunohistochemical detection of Influenza virus infection in formalin-fixed tissues with anti-H5 monoclonal antibody recognizing FFWTILKP.

    ID: 1598503

    Description: epitope description:FFWTILKP antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:7H10

    Publication: 18930768;

  4. Immunohistochemical detection of Influenza virus infection in formalin-fixed tissues with anti-H5 monoclonal antibody recognizing FFWTILKP.

    ID: 1598504

    Description: epitope description:FFWTILKP antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:7H10

    Publication: 18930768;

  5. Universal antibodies and their applications to the quantitative determination of virtually all subtypes of the influenza A viral hemagglutinins.

    ID: 1598509

    Description: epitope description:GLFGAIAGFIEGGW antigen name:Hemagglutinin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19007587;

  6. Antigenic structure of the hemagglutinin of H9N2 influenza viruses.

    ID: 1598514

    Description: epitope description:G90 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:L6/2

    Publication: 18989614;

  7. Matrix protein 2 vaccination and protection against influenza viruses, including subtype H5N1.

    ID: 1598516

    Description: epitope description:MSLLTEVETPTKNEWECRCNDSSD antigen name:Matrix protein 2 host organism:Mus musculus Nude

    Publication: 17552096;

  8. Universal antibodies and their applications to the quantitative determination of virtually all subtypes of the influenza A viral hemagglutinins.

    ID: 1598536

    Description: epitope description:GIFGAIAGFIEGGW antigen name:Hemagglutinin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19007587;

  9. Antigenic structure of the hemagglutinin of H9N2 influenza viruses.

    ID: 1598540

    Description: epitope description:T200, N201 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:E2/3, L7/7

    Publication: 18989614;

  10. Matrix protein 2 vaccination and protection against influenza viruses, including subtype H5N1.

    ID: 1598544

    Description: epitope description:MSLLTEVETPTKNEWECRCNDSSD antigen name:Matrix protein 2 host organism:Mus musculus Nude

    Publication: 17552096;

  11. Universal antibodies and their applications to the quantitative determination of virtually all subtypes of the influenza A viral hemagglutinins.

    ID: 1598547

    Description: epitope description:GIFGAIAGFIENGW antigen name:Hemagglutinin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19007587;

  12. Universal antibodies and their applications to the quantitative determination of virtually all subtypes of the influenza A viral hemagglutinins.

    ID: 1598554

    Description: epitope description:GLFGAIAGFIEGGW antigen name:Hemagglutinin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19007587;

  13. Universal antibodies and their applications to the quantitative determination of virtually all subtypes of the influenza A viral hemagglutinins.

    ID: 1598557

    Description: epitope description:GLFGAIAGFIEGGW antigen name:Hemagglutinin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19007587;

  14. Antigenic structure of the hemagglutinin of H9N2 influenza viruses.

    ID: 1598567

    Description: epitope description:S109, K113, N165 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:D272/6

    Publication: 18989614;

  15. Matrix protein 2 vaccination and protection against influenza viruses, including subtype H5N1.

    ID: 1598569

    Description: epitope description:MSLLTEVETPTKNEWECRCNDSSD antigen name:Matrix protein 2 host organism:Mus musculus Nude

    Publication: 17552096;

  16. Matrix protein 2 vaccination and protection against influenza viruses, including subtype H5N1.

    ID: 1598570

    Description: epitope description:MSLLTEVETPTRNEWECRCSDSSD antigen name:Matrix protein 2 host organism:Mus musculus Nude

    Publication: 17552096;

  17. Antigenic structure of the hemagglutinin of H9N2 influenza viruses.

    ID: 1598577

    Description: epitope description:L80 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:D370/4

    Publication: 18989614;

  18. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598592

    Description: epitope description:Q131, I132, I133, P134, E142, A143, S144, L145 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:FLA5.10

    Publication: 19381279;

  19. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598594

    Description: epitope description:S137, W138, S139, Y180, N181, N182, T183 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:FLD21.140

    Publication: 19381279;

  20. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598598

    Description: epitope description:S137, W138, S139, Y180, N181, N182, T183 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:FLD21.140

    Publication: 19381279;

  21. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598863

    Description: epitope description:S137, W138, S139, Y180, N181, N182, T183 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:FLD21.140

    Publication: 19381279;

  22. Cross-protective potential of a novel monoclonal antibody directed against antigenic site B of the hemagglutinin of influenza A viruses.

    ID: 1598879

    Description: epitope description:K172, G174, S209 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:S139/1

    Publication: 19300497;

  23. Cross-protective potential of a novel monoclonal antibody directed against antigenic site B of the hemagglutinin of influenza A viruses.

    ID: 1598890

    Description: epitope description:K172, G174, S209 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:S139/1

    Publication: 19300497;

  24. Cross-protective potential of a novel monoclonal antibody directed against antigenic site B of the hemagglutinin of influenza A viruses.

    ID: 1598893

    Description: epitope description:K172, G174, S209 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:S139/1

    Publication: 19300497;

  25. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598917

    Description: epitope description:QKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNK antigen name:Hemagglutinin host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  26. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598924

    Description: epitope description:VNSDTVGWSWPDGAELPFTID antigen name:Neuraminidase host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  27. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598947

    Description: epitope description:LMDHYLRIMSPVGTHKQIVYWKQWLSLKNPTQG antigen name:Protein PB1-F2 host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  28. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598970

    Description: epitope description:HPNSSAGLRDNLLENLQAYQKRMGVQMQRF antigen name:Matrix protein 1 host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  29. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598973

    Description: epitope description:ADQELGDAPFLDRLRRDQKS antigen name:Non-structural protein 1 host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  30. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598977

    Description: epitope description:EKANPVNDLCYPGDFNDYEELKH antigen name:Hemagglutinin host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  31. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598989

    Description: epitope description:QKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNK antigen name:Hemagglutinin host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  32. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598990

    Description: epitope description:DYPQYSEEARLKREEISGVKLESIGIYQI antigen name:Hemagglutinin host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  33. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598992

    Description: epitope description:DNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKH antigen name:Neuraminidase host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  34. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598994

    Description: epitope description:HKIFKMEKGKVVKSVELDAPNYHY antigen name:Neuraminidase host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  35. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1599004

    Description: epitope description:MASQGTKRSYEQMETGGERQNATE antigen name:Nucleoprotein host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  36. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602865

    Description: epitope description:YCSTWDANKP antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  37. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602873

    Description: epitope description:KPYSWRSKYG antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  38. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602874

    Description: epitope description:PYSWRSKYGW antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  39. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602879

    Description: epitope description:SKYGWTAFCG antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  40. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602880

    Description: epitope description:KYGWTAFCGP antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  41. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602887

    Description: epitope description:CGPVGAHGQS antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  42. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603189

    Description: epitope description:GERTRGRQPGDYDDD antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  43. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603192

    Description: epitope description:GRWGPAGPREREREE antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  44. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603198

    Description: epitope description:PGSHVREETSRNNPF antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  45. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603201

    Description: epitope description:RYGNQNGRIRVLQRF antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  46. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603203

    Description: epitope description:QRSRQFQNLQNHRIV antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  47. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603205

    Description: epitope description:IEAKPNTLVLPKHAD antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  48. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603212

    Description: epitope description:YILNRHDNQNLRVAK antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  49. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603215

    Description: epitope description:QFEDFFPASSRDQSS antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  50. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603220

    Description: epitope description:LEENAGGEQEERGQR antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston