Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

ID: 1590143

Description: epitope description:NVPKINPKKD antigen name:UniProt:I6TX52 host organism:Homo sapiens

A peptide-based human T cell leukemia virus type I vaccine containing T and B cell epitopes that induces high titers of neutralizing antibodies.

ID: 1590151

Description: epitope description:LPHSNLDHIL antigen name:Envelope glycoprotein gp62 host organism:Rattus norvegicus WKAH

Genetic and antigenic variation of capsid protein VP7 of serotype G1 human rotavirus isolates.

ID: 1590164

Description: epitope description:N94 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:RV4:3

Cross-reactive and serotype-specific neutralization epitopes on VP7 of human rotavirus: nucleotide sequence analysis of antigenic mutants selected wit...

ID: 1590166

Description: epitope description:D213 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus antibody name:KU-4

Cross-reactive and serotype-specific neutralization epitopes on VP7 of human rotavirus: nucleotide sequence analysis of antigenic mutants selected wit...

ID: 1590180

Description: epitope description:N94 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus antibody name:YO-4C2

Cross-reactive and serotype-specific neutralization epitopes on VP7 of human rotavirus: nucleotide sequence analysis of antigenic mutants selected wit...

ID: 1590192

Description: epitope description:W98 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus antibody name:YO-4C2

Human IgE binding capacity of tryptic peptides from bovine alpha-lactalbumin.

ID: 1590238

Description: epitope description:IWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKK + MCM(C3, C15, C19, C33) antigen name:Bos d 4 host organism:Homo sapiens

Human IgE binding capacity of tryptic peptides from bovine alpha-lactalbumin.

ID: 1590239

Description: epitope description:ALCSEKLDQWLCEKL + MCM(C3, C12) antigen name:Bos d 4 host organism:Homo sapiens

Human IgE binding capacity of tryptic peptides from bovine alpha-lactalbumin.

ID: 1590249

Description: epitope description:IWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVK + MCM(C3, C15, C19, C33) antigen name:Bos d 4 host organism:Homo sapiens

Mapping of B-cell epitopes on the outer membrane P2 porin protein of Haemophilus influenzae by using recombinant proteins and synthetic peptides.

ID: 1593073

Description: epitope description:GANYLLAQKREGAKGENKRPNDKAGEV antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:P2-3

Mapping of B-cell epitopes on the outer membrane P2 porin protein of Haemophilus influenzae by using recombinant proteins and synthetic peptides.

ID: 1593083

Description: epitope description:VDNQKQQHGALRNQGSRFHIKATHNFGD antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:P2-17

Mapping of B-cell epitopes on the outer membrane P2 porin protein of Haemophilus influenzae by using recombinant proteins and synthetic peptides.

ID: 1593086

Description: epitope description:ARTRTTETGKGVKTEKEKSVGVGLRVYF antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:P2-10

Mapping of B-cell epitopes on the outer membrane P2 porin protein of Haemophilus influenzae by using recombinant proteins and synthetic peptides.

ID: 1593089

Description: epitope description:EGAKGENKRPNDKAGEV antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:P2-3

Mapping of B-cell epitopes on the outer membrane P2 porin protein of Haemophilus influenzae by using recombinant proteins and synthetic peptides.

ID: 1593093

Description: epitope description:EGAKGENKRPNDKAGEV antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:P2-7

Mapping of B-cell epitopes on the outer membrane P2 porin protein of Haemophilus influenzae by using recombinant proteins and synthetic peptides.

ID: 1593095

Description: epitope description:EGAKGENKRPNDKAGEV antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:P2-12

Identification of common epitopes on gliadin, enterocytes, and calreticulin recognised by antigliadin antibodies of patients with coeliac disease.

ID: 1593108

Description: epitope description:YPQPQPFPSQQP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens antibody name:an...

Identification of common epitopes on gliadin, enterocytes, and calreticulin recognised by antigliadin antibodies of patients with coeliac disease.

ID: 1593111

Description: epitope description:FPQPQLPYSQPQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens antibody name:an...

Identification of common epitopes on gliadin, enterocytes, and calreticulin recognised by antigliadin antibodies of patients with coeliac disease.

ID: 1593113

Description: epitope description:PFRPQQPYPQPQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens antibody name:an...

Identification of common epitopes on gliadin, enterocytes, and calreticulin recognised by antigliadin antibodies of patients with coeliac disease.

ID: 1593118

Description: epitope description:LQQQLIPCMDVV antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens antibody name:an...

Identification of common epitopes on gliadin, enterocytes, and calreticulin recognised by antigliadin antibodies of patients with coeliac disease.

ID: 1593120

Description: epitope description:LQQHNIAHGRSQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens antibody name:an...