Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Molecular cloning and epitope analysis of the peanut allergen Ara h 3.

    ID: 1475955

    Description: epitope description:EEEGAIVTVRGGLRI antigen name:Ara h 3 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 10021462;

  2. Molecular cloning and epitope analysis of the peanut allergen Ara h 3.

    ID: 1475963

    Description: epitope description:KKNIGRNRSPDIYNP antigen name:Ara h 3 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 10021462;

  3. Molecular cloning and epitope analysis of the peanut allergen Ara h 3.

    ID: 1475964

    Description: epitope description:SPDIYNPQAGSLKTA antigen name:Ara h 3 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 10021462;

  4. Molecular cloning and epitope analysis of the peanut allergen Ara h 3.

    ID: 1475970

    Description: epitope description:AHSIIYRLRGRAHVQ antigen name:Ara h 3 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 10021462;

  5. Molecular cloning and epitope analysis of the peanut allergen Ara h 3.

    ID: 1475974

    Description: epitope description:HVLVVPQNFAVAGKS antigen name:Ara h 3 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 10021462;

  6. Molecular cloning and epitope analysis of the peanut allergen Ara h 3.

    ID: 1475987

    Description: epitope description:DEDEYEYDEEDRRRG antigen name:Ara h 3 host organism:Homo sapiens antibody name:human sera

    Publication: 10021462;

  7. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1475993

    Description: epitope description:APGICIDVDNEDLFFIADK antigen name:Botulinum neurotoxin type B host organism:Homo sapiens antibody name:Human sera

    Publication: 17897717;

  8. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1475994

    Description: epitope description:FIADKNSFSDDLSKNERIE antigen name:Botulinum neurotoxin type B host organism:Homo sapiens antibody name:Human sera

    Publication: 17897717;

  9. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1475995

    Description: epitope description:NERIEYNTQSNYIENDFPI antigen name:Botulinum neurotoxin type B host organism:Homo sapiens antibody name:Human sera

    Publication: 17897717;

  10. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476007

    Description: epitope description:IGLALNVGNETAKGNFENA antigen name:Botulinum neurotoxin type B host organism:Homo sapiens antibody name:Human sera

    Publication: 17897717;

  11. Molecular basis of IgE-recognition of Lol p 5, a major allergen of rye-grass pollen.

    ID: 1476008

    Description: epitope description:GAATAAAGGYKA antigen name:Other Lolium perenne (perennial ryegrass) protein host organism:Homo sapiens

    Publication: 9747889;

  12. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476014

    Description: epitope description:SDMYGLIVAQWLSTVNTQF antigen name:Botulinum neurotoxin type B host organism:Homo sapiens antibody name:Human sera

    Publication: 17897717;

  13. Molecular basis of IgE-recognition of Lol p 5, a major allergen of rye-grass pollen.

    ID: 1476018

    Description: epitope description:GAATAAAGGYKA antigen name:Other Lolium perenne (perennial ryegrass) protein host organism:Homo sapiens

    Publication: 9747889;

  14. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476021

    Description: epitope description:NIDFNDINSKLNEGINQAI antigen name:Botulinum neurotoxin type B host organism:Homo sapiens antibody name:Human sera

    Publication: 17897717;

  15. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476022

    Description: epitope description:INQAIDNINNFINGCSVSY antigen name:Botulinum neurotoxin type B host organism:Homo sapiens antibody name:Human sera

    Publication: 17897717;

  16. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476026

    Description: epitope description:SAEYEKSKVNKYLKTIMPF antigen name:Botulinum neurotoxin type B host organism:Homo sapiens antibody name:Human sera

    Publication: 17897717;

  17. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476031

    Description: epitope description:GVELNDKNQFKLTSSANSK antigen name:Botulinum neurotoxin type B host organism:Homo sapiens antibody name:Human sera

    Publication: 17897717;

  18. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476032

    Description: epitope description:SANSKIRVTQNQNIIFNSV antigen name:Botulinum neurotoxin type B host organism:Homo sapiens antibody name:Human sera

    Publication: 17897717;

  19. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476033

    Description: epitope description:IFNSVFLDFSVSFWIRIPK antigen name:Botulinum neurotoxin type B host organism:Homo sapiens antibody name:Human sera

    Publication: 17897717;

  20. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476035

    Description: epitope description:IHNEYTIINCMKNNSGWKI antigen name:Botulinum neurotoxin type B host organism:Homo sapiens antibody name:Human sera

    Publication: 17897717;

  21. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476040

    Description: epitope description:IYINGKLESNTDIKDIREV antigen name:Botulinum neurotoxin type B host organism:Homo sapiens antibody name:Human sera

    Publication: 17897717;

  22. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476049

    Description: epitope description:GEKFIIRRKSNSQSINDDI antigen name:Botulinum neurotoxin type B host organism:Homo sapiens antibody name:Human sera

    Publication: 17897717;

  23. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476050

    Description: epitope description:INDDIVRKEDYIYLDFFNL antigen name:Botulinum neurotoxin type B host organism:Homo sapiens antibody name:Human sera

    Publication: 17897717;

  24. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476052

    Description: epitope description:KYFKKEEEKLFLAPISDSD antigen name:Botulinum neurotoxin type B host organism:Homo sapiens antibody name:Human sera

    Publication: 17897717;

  25. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476056

    Description: epitope description:IHRFYESGIVFEEYKDYFC antigen name:Botulinum neurotoxin type B host organism:Homo sapiens antibody name:Human sera

    Publication: 17897717;

  26. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476057

    Description: epitope description:KDYFCISKWYLKEVKRKPY antigen name:Botulinum neurotoxin type B host organism:Homo sapiens antibody name:Human sera

    Publication: 17897717;

  27. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476060

    Description: epitope description:FIADKNSFSDDLSKNERIE antigen name:Botulinum neurotoxin type B host organism:Mus musculus ICR antibody name:Mouse sera

    Publication: 17897717;

  28. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476063

    Description: epitope description:ISKIELPSENTESLTDFNV antigen name:Botulinum neurotoxin type B host organism:Mus musculus ICR antibody name:Mouse sera

    Publication: 17897717;

  29. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476066

    Description: epitope description:YLYSQTFPLDIRDISLTSS antigen name:Botulinum neurotoxin type B host organism:Mus musculus ICR antibody name:Mouse sera

    Publication: 17897717;

  30. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476070

    Description: epitope description:QIVNDFVIEANKSNTMDKI antigen name:Botulinum neurotoxin type B host organism:Mus musculus ICR antibody name:Mouse sera

    Publication: 17897717;

  31. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476083

    Description: epitope description:CSVSYLMKKMIPLAVEKLL antigen name:Botulinum neurotoxin type B host organism:Mus musculus ICR antibody name:Mouse sera

    Publication: 17897717;

  32. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476084

    Description: epitope description:VEKLLDFDNTLKKNLLNYI antigen name:Botulinum neurotoxin type B host organism:Mus musculus ICR antibody name:Mouse sera

    Publication: 17897717;

  33. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476085

    Description: epitope description:LLNYIDENKLYLIGSAEYE antigen name:Botulinum neurotoxin type B host organism:Mus musculus ICR antibody name:Mouse sera

    Publication: 17897717;

  34. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476087

    Description: epitope description:TIMPFDLSIYTNDTILIEM antigen name:Botulinum neurotoxin type B host organism:Mus musculus ICR antibody name:Mouse sera

    Publication: 17897717;

  35. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476088

    Description: epitope description:ILIEMFNKYNSEILNNIIL antigen name:Botulinum neurotoxin type B host organism:Mus musculus ICR antibody name:Mouse sera

    Publication: 17897717;

  36. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476099

    Description: epitope description:WFFVTITNNLNNAKIYING antigen name:Botulinum neurotoxin type B host organism:Mus musculus ICR antibody name:Mouse sera

    Publication: 17897717;

  37. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476101

    Description: epitope description:DIREVIANGEIIFKLDGDI antigen name:Botulinum neurotoxin type B host organism:Mus musculus ICR antibody name:Mouse sera

    Publication: 17897717;

  38. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476102

    Description: epitope description:LDGDIDRTQFIWMKYFSIF antigen name:Botulinum neurotoxin type B host organism:Mus musculus ICR antibody name:Mouse sera

    Publication: 17897717;

  39. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476104

    Description: epitope description:EERYKIQSYSEYLKDFWGN antigen name:Botulinum neurotoxin type B host organism:Mus musculus ICR antibody name:Mouse sera

    Publication: 17897717;

  40. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476118

    Description: epitope description:KRKPYNLKLGCNWQFIPKDEGWTE antigen name:Botulinum neurotoxin type B host organism:Mus musculus ICR antibody name:Mouse sera

    Publication: 17897717;

  41. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476132

    Description: epitope description:TMDKIADISLIVPYIGLAL antigen name:Botulinum neurotoxin type B host organism:Equus caballus antibody name:Horse sera

    Publication: 17897717;

  42. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476133

    Description: epitope description:IGLALNVGNETAKGNFENA antigen name:Botulinum neurotoxin type B host organism:Equus caballus antibody name:Horse sera

    Publication: 17897717;

  43. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476138

    Description: epitope description:SDMYGLIVAQWLSTVNTQF antigen name:Botulinum neurotoxin type B host organism:Equus caballus antibody name:Horse sera

    Publication: 17897717;

  44. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476141

    Description: epitope description:YRYNIYSEKEKSNINIDFN antigen name:Botulinum neurotoxin type B host organism:Equus caballus antibody name:Horse sera

    Publication: 17897717;

  45. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476142

    Description: epitope description:NIDFNDINSKLNEGINQAI antigen name:Botulinum neurotoxin type B host organism:Equus caballus antibody name:Horse sera

    Publication: 17897717;

  46. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476143

    Description: epitope description:INQAIDNINNFINGCSVSY antigen name:Botulinum neurotoxin type B host organism:Equus caballus antibody name:Horse sera

    Publication: 17897717;

  47. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476148

    Description: epitope description:TIMPFDLSIYTNDTILIEM antigen name:Botulinum neurotoxin type B host organism:Equus caballus antibody name:Horse sera

    Publication: 17897717;

  48. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476158

    Description: epitope description:TLIDINGKTKSVFFEYNIR antigen name:Botulinum neurotoxin type B host organism:Equus caballus antibody name:Horse sera

    Publication: 17897717;

  49. Immune recognition of botulinum neurotoxin B: antibody-binding regions on the heavy chain of the toxin.

    ID: 1476161

    Description: epitope description:IYINGKLESNTDIKDIREV antigen name:Botulinum neurotoxin type B host organism:Equus caballus antibody name:Horse sera

    Publication: 17897717;

  50. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478771

    Description: epitope description:DAAGPVKVTVTNPGG antigen name:Cell surface protein host organism:Oncorhynchus tshawytscha antibody name:anti-p57

    Publication: 15932983;

  51. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478779

    Description: epitope description:ATLEPKTGPRDGGTV antigen name:Cell surface protein host organism:Oncorhynchus tshawytscha antibody name:anti-p57

    Publication: 15932983;

  52. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478790

    Description: epitope description:IAQDGNSLTVKTPAV antigen name:Cell surface protein host organism:Oncorhynchus tshawytscha antibody name:anti-p57

    Publication: 15932983;

  53. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478795

    Description: epitope description:VSTPNGSATATDKFE antigen name:Cell surface protein host organism:Capra hircus

    Publication: 15932983;

  54. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478799

    Description: epitope description:VGSDQHPDIHAPDGA antigen name:Cell surface protein host organism:Capra hircus

    Publication: 15932983;

  55. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478801

    Description: epitope description:IHAPDGATPVTGKWW antigen name:Cell surface protein host organism:Capra hircus

    Publication: 15932983;

  56. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478810

    Description: epitope description:LQKPNAGSVSVAFGN antigen name:Cell surface protein host organism:Oncorhynchus tshawytscha antibody name:anti-p57

    Publication: 15932983;

  57. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478814

    Description: epitope description:GDTPVTGDWDGKGRF antigen name:Cell surface protein host organism:Oncorhynchus tshawytscha antibody name:anti-p57

    Publication: 15932983;

  58. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478820

    Description: epitope description:WYLSNAGTSIGKVTA antigen name:Cell surface protein host organism:Oncorhynchus tshawytscha antibody name:anti-p57

    Publication: 15932983;

  59. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478825

    Description: epitope description:TPVTGDWDGKGKTSI antigen name:Cell surface protein host organism:Capra hircus

    Publication: 15932983;

  60. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478836

    Description: epitope description:SYHFIFGNSTDAPIT antigen name:Cell surface protein host organism:Oncorhynchus tshawytscha antibody name:anti-p57

    Publication: 15932983;

  61. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478842

    Description: epitope description:QVGLHRENSILISYD antigen name:Cell surface protein host organism:Oncorhynchus tshawytscha antibody name:anti-p57

    Publication: 15932983;

  62. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478847

    Description: epitope description:FGNAGDVAVTGQWNG antigen name:Cell surface protein host organism:Capra hircus

    Publication: 15932983;

  63. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478851

    Description: epitope description:GKTSFGVFEHSSGAW antigen name:Cell surface protein host organism:Capra hircus

    Publication: 15932983;

  64. Structure-based identification of a major neutralizing site in an adenovirus hexon.

    ID: 1478866

    Description: epitope description:KDGIQLGTDTDDQPIYADK antigen name:Chimpanzee adenovirus protein host organism:Oryctolagus cuniculus

    Publication: 17108028;

  65. Structure-based identification of a major neutralizing site in an adenovirus hexon.

    ID: 1478869

    Description: epitope description:KANGTDQTTWTKDD antigen name:Chimpanzee adenovirus protein host organism:Oryctolagus cuniculus

    Publication: 17108028;

  66. Identification and immunogenicity of an immunodominant mimotope of Avibacterium paragallinarum from a phage display peptide library.

    ID: 1478877

    Description: epitope description:YGLLAVDPLFKP host organism:Gallus gallus White Leghorn

    Publication: 17049758;

  67. Identification and immunogenicity of an immunodominant mimotope of Avibacterium paragallinarum from a phage display peptide library.

    ID: 1478884

    Description: epitope description:KLSATDPLAHYK host organism:Gallus gallus White Leghorn

    Publication: 17049758;

  68. Identification and immunogenicity of an immunodominant mimotope of Avibacterium paragallinarum from a phage display peptide library.

    ID: 1478888

    Description: epitope description:HLGLMAMDHLPW host organism:Gallus gallus White Leghorn

    Publication: 17049758;

  69. Intranasal vaccination with a lipopeptide containing a conformationally constrained conserved minimal peptide, a universal T cell epitope, and a self-...

    ID: 1478891

    Description: epitope description:KQAEDKVKASREAKKQVEKALEQLEDKVK host organism:Mus musculus Quackenbush

    Publication: 16826480;

  70. Production and characterization of antibodies against each of the three subunits of the Bacillus cereus nonhemolytic enterotoxin complex.

    ID: 1478895

    Description: epitope description:VKDYTEKLHEGVAK antigen name:Non-expressed Enterotoxin C host organism:Oryctolagus cuniculus antibody name:anti-NheC

    Publication: 16332805;

  71. Characterization of a cross-reactive linear epitope in human genogroup I and bovine genogroup III norovirus capsid proteins.

    ID: 1478903

    Description: epitope description:LEDVRN antigen name:Capsid protein VP1 host organism:Mus musculus antibody name:CM54

    Publication: 16934306;

  72. Generation and characterisation of functional recombinant antibody fragments against RNA replicase NIb from plum pox virus.

    ID: 1478910

    Description: epitope description:YLEAFY antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:scFv2A

    Publication: 12535657;

  73. Generation and characterisation of functional recombinant antibody fragments against RNA replicase NIb from plum pox virus.

    ID: 1478911

    Description: epitope description:YLEAFY antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2A

    Publication: 12535657;

  74. Characterization of a linear epitope on Chlamydia trachomatis serovar L2 DnaK-like protein.

    ID: 1478982

    Description: epitope description:NKGVNPDE antigen name:Chaperone protein DnaK host organism:Mus musculus BALB/c antibody name:35.2

    Publication: 7513310;

  75. Identification of neutralizing epitopes on the VP2 protein of infectious bursal disease virus by phage-displayed heptapeptide library screening and sy...

    ID: 1478991

    Description: epitope description:CDSSDRPRVYTIT antigen name:Structural polyprotein host organism:Gallus gallus

    Publication: 16212534;

  76. Identification of neutralizing epitopes on the VP2 protein of infectious bursal disease virus by phage-displayed heptapeptide library screening and sy...

    ID: 1479011

    Description: epitope description:ARGSLAVTI antigen name:Structural polyprotein host organism:Mus musculus antibody name:YNW29

    Publication: 16212534;

  77. Identification of neutralizing epitopes on the VP2 protein of infectious bursal disease virus by phage-displayed heptapeptide library screening and sy...

    ID: 1479016

    Description: epitope description:ARGSLAVTI antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 16212534;

  78. Circulating antibodies to a conserved epitope of the Chlamydia trachomatis 60-kDa heat shock protein is associated with decreased spontaneous fertilit...

    ID: 1479020

    Description: epitope description:ATLVVNRIRGGF antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 18211535;

  79. Epitope mapping and use of epitope-specific antisera to characterize the VP5* binding site in rotavirus SA11 NSP4.

    ID: 1479024

    Description: epitope description:DRVVKEMRRQLEMIDKLTT antigen name:Non-structural glycoprotein 4 host organism:Mus musculus antibody name:B4-2/55

    Publication: 18164740;

  80. Epitope mapping and use of epitope-specific antisera to characterize the VP5* binding site in rotavirus SA11 NSP4.

    ID: 1479071

    Description: epitope description:DRVVKEMRRQLEMIDKLTT antigen name:Non-structural glycoprotein 4 host organism:Mus musculus antibody name:B4-2/55

    Publication: 18164740;

  81. Epitope mapping and use of epitope-specific antisera to characterize the VP5* binding site in rotavirus SA11 NSP4.

    ID: 1479082

    Description: epitope description:DKLTTREIEQVE antigen name:Non-structural glycoprotein 4 host organism:Oryctolagus cuniculus

    Publication: 18164740;

  82. Epitope mapping of the major inner capsid protein of group A rotavirus using peptide synthesis.

    ID: 1479137

    Description: epitope description:SFP antigen name:Intermediate capsid protein VP6 host organism:Mus musculus antibody name:RV-50

    Publication: 7683153;

  83. Epitope mapping of the major inner capsid protein of group A rotavirus using peptide synthesis.

    ID: 1479142

    Description: epitope description:ERFSFPR antigen name:Intermediate capsid protein VP6 host organism:Mus musculus antibody name:RV-133

    Publication: 7683153;

  84. Epitope mapping of the major inner capsid protein of group A rotavirus using peptide synthesis.

    ID: 1479144

    Description: epitope description:SASFT antigen name:Intermediate capsid protein VP6 host organism:Mus musculus antibody name:RV-138

    Publication: 7683153;

  85. Epitope mapping of the major inner capsid protein of group A rotavirus using peptide synthesis.

    ID: 1479146

    Description: epitope description:QIINTY antigen name:Intermediate capsid protein VP6 host organism:Mus musculus antibody name:RV-138

    Publication: 7683153;

  86. Immunogenicity of peptides of measles virus origin and influence of adjuvants.

    ID: 1479152

    Description: epitope description:KPNLSSKRSELSQLS antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c

    Publication: 16122851;

  87. Epitope mapping and use of epitope-specific antisera to characterize the VP5* binding site in rotavirus SA11 NSP4.

    ID: 1479153

    Description: epitope description:TLEEWESGKNPYEPRE antigen name:Non-structural glycoprotein 4 host organism:Oryctolagus cuniculus

    Publication: 18164740;

  88. Epitope mapping and use of epitope-specific antisera to characterize the VP5* binding site in rotavirus SA11 NSP4.

    ID: 1479154

    Description: epitope description:TLEEWESGKNPYEPRE antigen name:Non-structural glycoprotein 4 host organism:Oryctolagus cuniculus

    Publication: 18164740;

  89. Epitope mapping porcine reproductive and respiratory syndrome virus by phage display: the nsp2 fragment of the replicase polyprotein contains a cluste...

    ID: 1479224

    Description: epitope description:HHPVDLADWELIESPED antigen name:Replicase polyprotein 1ab host organism:Sus scrofa antibody name:42-dpi

    Publication: 11238854;

  90. Epitope mapping porcine reproductive and respiratory syndrome virus by phage display: the nsp2 fragment of the replicase polyprotein contains a cluste...

    ID: 1479227

    Description: epitope description:QERGHKAPHPAVLAGGLSKQQVQVVEGGRSGL antigen name:Replicase polyprotein 1ab host organism:Sus scrofa antibody name:42-dpi

    Publication: 11238854;

  91. Epitope mapping porcine reproductive and respiratory syndrome virus by phage display: the nsp2 fragment of the replicase polyprotein contains a cluste...

    ID: 1479231

    Description: epitope description:QPLNLSLAAWP antigen name:Replicase polyprotein 1ab host organism:Sus scrofa antibody name:42-dpi

    Publication: 11238854;

  92. Synthetic peptides induce antibody against a host-protective antigen of Echinococcus granulosus.

    ID: 1479255

    Description: epitope description:TETPLRKHFNLTPV antigen name:Antigen protein host organism:Ovis aries antibody name:sheep serum

    Publication: 10580190;

  93. Effect of adjuvant composition on immune response to a multiple antigen peptide (MAP) containing a protective epitope from Neisseria meningitidis clas...

    ID: 1479326

    Description: epitope description:TKNTNNNLTL antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 10501243;

  94. Posttranslational processing and identification of a neutralization domain of the GP4 protein encoded by ORF4 of Lelystad virus.

    ID: 1479342

    Description: epitope description:AAAGFMVLQDINCFRPHGVSAAQEKISFGKSSQCREAVGT antigen name:Glycoprotein 4 host organism:Mus musculus antibody name:121.4, 122.1, 122.20...

    Publication: 9223499;

  95. Posttranslational processing and identification of a neutralization domain of the GP4 protein encoded by ORF4 of Lelystad virus.

    ID: 1479346

    Description: epitope description:AAAGFMVLQDINCFRPHGVSAAQEKISFGKSSQCREAVGT antigen name:Glycoprotein 4 host organism:Mus musculus antibody name:122.1, 122.20, 122.5...

    Publication: 9223499;

  96. Posttranslational processing and identification of a neutralization domain of the GP4 protein encoded by ORF4 of Lelystad virus.

    ID: 1479349

    Description: epitope description:QEKISFGKSSQCREAV antigen name:Glycoprotein 4 host organism:Oryctolagus cuniculus antibody name:serum 698

    Publication: 9223499;

  97. Identification of critical residues of an immunodominant region of Echinococcus granulosus antigen B.

    ID: 1479363

    Description: epitope description:KMFGEVKYFFERDPLGQKVVDLLKEL antigen name:AntigenB host organism:Homo sapiens

    Publication: 12660242;

  98. Synthetic peptides induce antibody against a host-protective antigen of Echinococcus granulosus.

    ID: 1479368

    Description: epitope description:SLKAVNPSDPLVYKRQTAKF antigen name:Antigen protein host organism:Ovis aries antibody name:affinity purified sheep serum

    Publication: 10580190;

  99. Neutralizing antibody to Mengo virus, induced by synthetic peptides.

    ID: 1479373

    Description: epitope description:PTSGDKIDMTPRAGVLMLE antigen name:Cardiovirus A protein host organism:Mus musculus BALB/cByJ antibody name:anti-F164

    Publication: 1709682;

  100. Neutralizing antibody to Mengo virus, induced by synthetic peptides.

    ID: 1479374

    Description: epitope description:PTSGDKIDMTPRAGVLMLE antigen name:Cardiovirus A protein host organism:Mus musculus BALB/cByJ antibody name:anti-F164

    Publication: 1709682;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston