Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Characterization of the nucleocapsid protein of Hantaan virus strain 76-118 using monoclonal antibodies.

    ID: 1459184

    Description: epitope description:EDVNGIRKPK antigen name:Hantaan orthohantavirus protein host organism:Mus musculus BALB/c antibody name:MAb E5/G6

    Publication: 8627258;

  2. Characterization of the nucleocapsid protein of Hantaan virus strain 76-118 using monoclonal antibodies.

    ID: 1459189

    Description: epitope description:EDVNGIRKPK antigen name:Hantaan orthohantavirus protein host organism:Mus musculus BALB/c antibody name:MAb E5/G6

    Publication: 8627258;

  3. Characterization of B cell epitopes on the 16K antigen of Mycobacterium tuberculosis.

    ID: 1459481

    Description: epitope description:PRSLFPEFSELFAAFPSFAG antigen name:Alpha-crystallin host organism:Homo sapiens

    Publication: 1381300;

  4. Characterization of B cell epitopes on the 16K antigen of Mycobacterium tuberculosis.

    ID: 1459483

    Description: epitope description:DPDKDVDIMVRDGQLTIKAE antigen name:Alpha-crystallin host organism:Homo sapiens

    Publication: 1381300;

  5. Heterotypic protection induced by synthetic peptides corresponding to three serotypes of foot-and-mouth disease virus.

    ID: 1459492

    Description: epitope description:CCRHKQKIIAPAKQLLPPSGSGRRGDMGSLAARVVKQPCG host organism:Bos taurus antibody name:Cattle sera

    Publication: 2157884;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston