Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594714

    Description: epitope description:TAWNPSLL antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  2. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594716

    Description: epitope description:LTAWNPSL antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  3. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594720

    Description: epitope description:NLTAWNPS antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  4. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594723

    Description: epitope description:LNLTAWNP antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  5. Major antigenic determinants of F and ColB2 pili.

    ID: 1584506

    Description: epitope description:AQGQDL antigen name:Plasmid ColB2 protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2409073;

  6. Isolation of antigenically reactive peptide fragments and localization of antigenic regions of alpha-bungarotoxin.

    ID: 1584524

    Description: epitope description:RKM antigen name:Alpha-bungarotoxin isoform A31 host organism:Oryctolagus cuniculus

    Publication: 2458724;

  7. Isolation of antigenically reactive peptide fragments and localization of antigenic regions of alpha-bungarotoxin.

    ID: 1584529

    Description: epitope description:TTATSPISA antigen name:Alpha-bungarotoxin isoform A31 host organism:Oryctolagus cuniculus

    Publication: 2458724;

  8. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584633

    Description: epitope description:LNGKIRAVNLPKVTKEKPTP antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  9. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584637

    Description: epitope description:APNYEKEPTPPTRTPDQAEP antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  10. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584638

    Description: epitope description:PTRTPDQAEPKKPTPPTYET antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  11. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584642

    Description: epitope description:PTPTPDQPEPNKPVEPTYEV antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  12. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584645

    Description: epitope description:QDLPTPPSIPTVHFHYFKLA antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  13. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584647

    Description: epitope description:VQPQVNKEIRNNNDVNIDRT antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  14. A monoclonal antibody that recognizes the predicted tick-borne encephalitis virus E protein fusion sequence blocks fusion.

    ID: 1583852

    Description: epitope description:DRGWGNHCGLFGKGSI antigen name:Genome polyprotein host organism:Mus musculus antibody name:14D2

    Publication: 10416385;

  15. Protective immunogenicity and T lymphocyte specificity of a trivalent hybrid peptide containing NH2-terminal sequences of types 5, 6, and 24 M protein...

    ID: 1583878

    Description: epitope description:RVFPRGTVENP antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2442284;

  16. Protective immunogenicity and T lymphocyte specificity of a trivalent hybrid peptide containing NH2-terminal sequences of types 5, 6, and 24 M protein...

    ID: 1583888

    Description: epitope description:TVTRGTISDPRVFPRGTVENPVATRSQTDTSEKDC host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2442284;

  17. Identification of hepatitis G virus particles in human serum by E2-specific monoclonal antibodies generated by DNA immunization.

    ID: 1583951

    Description: epitope description:LTGGFYEPL antigen name:Pegivirus C protein host organism:Mus musculus BALB/c antibody name:Mc6

    Publication: 9557757;

  18. Epitope mapping of the outer membrane protein P5-homologous fimbrin adhesin of nontypeable Haemophilus influenzae.

    ID: 1584084

    Description: epitope description:SFHDGINNNGAIKKGLSSSNYGYRRNTF antigen name:Outer membrane protein A (3aII*Gd) host organism:Chinchilla lanigera antibody name:Chinc...

    Publication: 10722609;

  19. The major outer membrane protein of Chlamydia trachomatis: critical binding site and conformation determine the specificity of antibody binding to via...

    ID: 1584090

    Description: epitope description:IFDT antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:6Ciii

    Publication: 2473372;

  20. Antigenic structure of the nucleocapsid protein of porcine reproductive and respiratory syndrome virus.

    ID: 1584091

    Description: epitope description:IVQQNQSRGKGPGKKNKKKNPEK antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:SDOW17

    Publication: 9801333;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston