Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Topography and immunogenicity of bluetongue virus VP7 epitopes.

    ID: 1478400

    Description: epitope description:ARQPYGFFLETEEVYQPG antigen name:Core protein VP7 host organism:Oryctolagus cuniculus antibody name:OAB

    Publication: 8629938;

  2. Topography and immunogenicity of bluetongue virus VP7 epitopes.

    ID: 1478405

    Description: epitope description:GVTVSVGGVDMRAGRIIAWDGQAALQIHNPTQQN antigen name:Core protein VP7 host organism:Oryctolagus cuniculus antibody name:Rabbit anti-ser...

    Publication: 8629938;

  3. Topography and immunogenicity of bluetongue virus VP7 epitopes.

    ID: 1478406

    Description: epitope description:QYPALT antigen name:Core protein VP7 host organism:Mus musculus antibody name:20D11, 20F10

    Publication: 8629938;

  4. Characterisation of mouse monoclonal antibodies for pneumolysin: fine epitope mapping and V gene usage.

    ID: 1478418

    Description: epitope description:RPPRYLANQ host organism:Mus musculus BALB/c antibody name:PLY-4

    Publication: 12941482;

  5. Characterisation of mouse monoclonal antibodies for pneumolysin: fine epitope mapping and V gene usage.

    ID: 1478420

    Description: epitope description:RLPRYMQEV host organism:Mus musculus BALB/c antibody name:PLY-4

    Publication: 12941482;

  6. Characterisation of mouse monoclonal antibodies for pneumolysin: fine epitope mapping and V gene usage.

    ID: 1478427

    Description: epitope description:GGQTFTDRE host organism:Mus musculus BALB/c antibody name:PLY-7

    Publication: 12941482;

  7. Efficient neutralization of foot-and-mouth disease virus by monovalent antibody binding.

    ID: 1478436

    Description: epitope description:YTASARGDLAHL antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:SD6

    Publication: 9371652;

  8. Antigenicity of a synthetic peptide from glucosyltransferases of Streptococcus mutans in humans.

    ID: 1478452

    Description: epitope description:ANDVDNSNPVVQAEQLNWL antigen name:UniProt:I6TQ53 host organism:Homo sapiens

    Publication: 9038329;

  9. The conserved undecapeptide shared by thiol-activated cytolysins is involved in membrane binding.

    ID: 1478454

    Description: epitope description:ECTGLAWEWWRT antigen name:Pneumolysin host organism:Mus musculus BALB/c antibody name:PLY-5

    Publication: 10526185;

  10. The conserved undecapeptide shared by thiol-activated cytolysins is involved in membrane binding.

    ID: 1478458

    Description: epitope description:ECTGLAWEWWRT antigen name:Pneumolysin host organism:Mus musculus BALB/c antibody name:PLY-5

    Publication: 10526185;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston