Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. An antigenic peptide inducing cross-reacting antibodies inhibiting the interaction of Streptococcus mutans PAc with human salivary components.

    ID: 1586680

    Description: epitope description:YQAKLTAYQTELARVQKAN antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 7591125;

  2. Anaplasma marginale major surface protein 2 CD4+-T-cell epitopes are evenly distributed in conserved and hypervariable regions (HVR), whereas linear B...

    ID: 1587098

    Description: epitope description:AGAFARAVEGAEVIEVRAIGSTSVMLNACY antigen name:Major surface protein 2 (MSP2) host organism:Bos taurus

    Publication: 15557669;

  3. Anaplasma marginale major surface protein 2 CD4+-T-cell epitopes are evenly distributed in conserved and hypervariable regions (HVR), whereas linear B...

    ID: 1587100

    Description: epitope description:PYACAGIGGNFVSVVDGHINPKFAYRVKAG antigen name:Major surface protein 2 (MSP2) host organism:Bos taurus

    Publication: 15557669;

  4. Anaplasma marginale major surface protein 2 CD4+-T-cell epitopes are evenly distributed in conserved and hypervariable regions (HVR), whereas linear B...

    ID: 1587109

    Description: epitope description:EGNKDTINLQGMANNINNLSKEDKAV antigen name:Major surface protein 2 (MSP2) host organism:Bos taurus

    Publication: 15557669;

  5. Mapping of immunogenic regions of human T cell leukemia virus type I (HTLV-I) gp46 and gp21 envelope glycoproteins with env-encoded synthetic peptides...

    ID: 1587150

    Description: epitope description:LLPHSNLDHILEPSIPWKSK antigen name:Envelope glycoprotein gp62 host organism:Mus musculus BALB/c antibody name:1C11

    Publication: 2563272;

  6. Mapping of immunogenic regions of human T cell leukemia virus type I (HTLV-I) gp46 and gp21 envelope glycoproteins with env-encoded synthetic peptides...

    ID: 1587152

    Description: epitope description:LLPHSNLDHILEPSIPWKSK antigen name:Envelope glycoprotein gp62 host organism:Mus musculus BALB/c antibody name:1C11

    Publication: 2563272;

  7. Mapping of immunogenic regions of human T cell leukemia virus type I (HTLV-I) gp46 and gp21 envelope glycoproteins with env-encoded synthetic peptides...

    ID: 1587153

    Description: epitope description:LLPHSNLDHILEPSIPWKSK antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 2563272;

  8. Mapping of immunogenic regions of human T cell leukemia virus type I (HTLV-I) gp46 and gp21 envelope glycoproteins with env-encoded synthetic peptides...

    ID: 1587154

    Description: epitope description:LLPHSNLDHILEPSIPWKSK antigen name:Envelope glycoprotein gp62 host organism:Mus musculus BALB/c antibody name:1C11

    Publication: 2563272;

  9. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587168

    Description: epitope description:EQCGRQAGGK antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  10. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587173

    Description: epitope description:RQAGGKLCPN antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  11. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587175

    Description: epitope description:AGGKLCPNNL antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  12. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587176

    Description: epitope description:GKLCPNNLCC antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  13. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587178

    Description: epitope description:LCPNNLCCSQ antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  14. Longitudinal analyses of immune responses to Plasmodium falciparum derived peptides corresponding to novel blood stage antigens in coastal Kenya.

    ID: 1587209

    Description: epitope description:QLEEKTKQYNDLQNNMKTIKEQNEHLKNKFQSMGK antigen name:Uncharacterized protein (UniProt:Q8IHV2) host organism:Homo sapiens

    Publication: 18342997;

  15. Longitudinal analyses of immune responses to Plasmodium falciparum derived peptides corresponding to novel blood stage antigens in coastal Kenya.

    ID: 1587210

    Description: epitope description:EKMNMKMEQMDMKMEKIDVNMDQMDVKMEQMDVKMEQMDVKMKRMNK antigen name:Uncharacterized protein PFB0315w host organism:Homo sapiens

    Publication: 18342997;

  16. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587250

    Description: epitope description:PDHNCQSNCK antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  17. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587298

    Description: epitope description:SASNVLATYH antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  18. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587300

    Description: epitope description:SNVLATYHLY antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  19. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587303

    Description: epitope description:VLATYHLYNS antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  20. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587309

    Description: epitope description:LYNSQDHGWD antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston