Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Association of the outcome of renal transplantation with antibody response to cytomegalovirus strain-specific glycoprotein H epitopes.

    ID: 1462558

    Description: epitope description:LDKAFHLLL antigen name:Envelope glycoprotein H host organism:Homo sapiens

    Publication: 17554702;

  2. Immunogenicity of a chimeric peptide corresponding to T helper and B cell epitopes of the Chlamydia trachomatis major outer membrane protein.

    ID: 1462570

    Description: epitope description:GAAPTTSDVAGLEKDPVANVA host organism:Mus musculus A.SW antibody name:Anti-A8-VD1

    Publication: 1370528;

  3. Immunogenicity of a chimeric peptide corresponding to T helper and B cell epitopes of the Chlamydia trachomatis major outer membrane protein.

    ID: 1462585

    Description: epitope description:GAAPTTSDVAGLEKDPVANVA host organism:Mus musculus A.SW antibody name:Anti-AVD1

    Publication: 1370528;

  4. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera.

    ID: 1462597

    Description: epitope description:KQPQPRLRVKTPPPVTVP antigen name:Envelope glycoprotein E host organism:Equus caballus

    Publication: 10921846;

  5. Immunogenicity of a chimeric peptide corresponding to T helper and B cell epitopes of the Chlamydia trachomatis major outer membrane protein.

    ID: 1462671

    Description: epitope description:TTSDVAGLEKDPVAN host organism:Mus musculus CBA antibody name:Anti-AVD1

    Publication: 1370528;

  6. Immunogenicity of a chimeric peptide corresponding to T helper and B cell epitopes of the Chlamydia trachomatis major outer membrane protein.

    ID: 1462705

    Description: epitope description:DVAGLEKDPVAN host organism:Mus musculus DBA/1 antibody name:Anti-AVD1

    Publication: 1370528;

  7. Immunogenicity of a chimeric peptide corresponding to T helper and B cell epitopes of the Chlamydia trachomatis major outer membrane protein.

    ID: 1462707

    Description: epitope description:DVAGLEKDPVAN host organism:Mus musculus DBA/1 antibody name:Anti-AVD1

    Publication: 1370528;

  8. Novel low-molecular-weight synthetic vaccine against foot-and-mouth disease containing a potent B-cell and macrophage activator.

    ID: 1462715

    Description: epitope description:RYNRNAVPNLRGDLQVLAQK antigen name:Polyprotein host organism:Cavia porcellus

    Publication: 2470215;

  9. Mapping epitopes in equine rhinitis A virus VP1 recognized by antibodies elicited in response to infection of the natural host.

    ID: 1462727

    Description: epitope description:LPVGAPTKTTDAWQLKGGGNSVRIQKLAVAGMSPTVVFKI antigen name:polyprotein host organism:Oryctolagus cuniculus antibody name:Rabbit antiser...

    Publication: 12771431;

  10. Mapping epitopes in equine rhinitis A virus VP1 recognized by antibodies elicited in response to infection of the natural host.

    ID: 1462730

    Description: epitope description:RPADKTRHKFPTNINKQ antigen name:polyprotein host organism:Oryctolagus cuniculus antibody name:Rabbit antiserum

    Publication: 12771431;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston