Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Neutralizing antibody to Mengo virus, induced by synthetic peptides.

    ID: 1479380

    Description: epitope description:YDQLRPQRLT antigen name:Cardiovirus A protein host organism:Mus musculus BALB/cByJ antibody name:anti-F136

    Publication: 1709682;

  2. Monoclonal antibodies to a peptide of human rhinovirus type 2 with different specificities recognize the same minimum sequence.

    ID: 1479387

    Description: epitope description:LNPDLQ antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:508, 509

    Publication: 7730811;

  3. Characterization of murine monoclonal antibodies that recognize defined epitopes of pertussis toxin and neutralize its toxic effect on Chinese hamster...

    ID: 1479404

    Description: epitope description:TATRLLSSTNSRLC antigen name:Pertussis toxin subunit 2 host organism:Mus musculus BALB/c antibody name:E251

    Publication: 1718872;

  4. Isolation and characterization of broadly neutralizing human monoclonal antibodies to the e1 glycoprotein of hepatitis C virus.

    ID: 1479418

    Description: epitope description:WDMMMNW antigen name:Genome polyprotein host organism:Homo sapiens antibody name:IGH450

    Publication: 17977972;

  5. Isolation and characterization of broadly neutralizing human monoclonal antibodies to the e1 glycoprotein of hepatitis C virus.

    ID: 1479420

    Description: epitope description:ITGHRMAWDMMMNWS antigen name:Genome polyprotein host organism:Homo sapiens antibody name:IGH505, IGH526

    Publication: 17977972;

  6. Immunogenicity and protective immunity induced by synthetic peptides associated with putative immunodominant regions of Streptococcus mutans glucan-bi...

    ID: 1479431

    Description: epitope description:KSNAATSYINAIINSKSVSD antigen name:UniProt:I6T4P1 host organism:Rattus norvegicus

    Publication: 12595430;

  7. Immunogenicity and protective immunity induced by synthetic peptides associated with putative immunodominant regions of Streptococcus mutans glucan-bi...

    ID: 1479435

    Description: epitope description:TIQGQVSALQTQQAE antigen name:UniProt:I6T4P1 host organism:Rattus norvegicus

    Publication: 12595430;

  8. Immunogenicity and protective immunity induced by synthetic peptides associated with putative immunodominant regions of Streptococcus mutans glucan-bi...

    ID: 1479436

    Description: epitope description:TIQGQVSALQTQQAE antigen name:UniProt:I6T4P1 host organism:Rattus norvegicus

    Publication: 12595430;

  9. A synthetic peptide which elicits neutralizing antibody against human rhinovirus type 2.

    ID: 1479448

    Description: epitope description:KHIHKDIGHC host organism:Oryctolagus cuniculus antibody name:anti-HRV2

    Publication: 2822846;

  10. A synthetic peptide which elicits neutralizing antibody against human rhinovirus type 2.

    ID: 1479451

    Description: epitope description:FCLRMARDTNLHLQSGAIAQ antigen name:Genome polyprotein host organism:Oryctolagus cuniculus antibody name:anti-HRV2

    Publication: 2822846;

  11. A synthetic peptide which elicits neutralizing antibody against human rhinovirus type 2.

    ID: 1479461

    Description: epitope description:VKAETRLNPDLQPTE antigen name:Genome polyprotein host organism:Oryctolagus cuniculus antibody name:anti-VP2 Peptide 4

    Publication: 2822846;

  12. A synthetic peptide which elicits neutralizing antibody against human rhinovirus type 2.

    ID: 1479463

    Description: epitope description:FCLRMARDTNLHLQSGAIAQ antigen name:Genome polyprotein host organism:Oryctolagus cuniculus antibody name:anti-VP3 Peptide 6

    Publication: 2822846;

  13. A neutralizing epitope on human rhinovirus type 2 includes amino acid residues between 153 and 164 of virus capsid protein VP2.

    ID: 1479467

    Description: epitope description:GREVKAETRLNP antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:8F5

    Publication: 2434607;

  14. Immunogenicity and protective immunity induced by synthetic peptides associated with putative immunodominant regions of Streptococcus mutans glucan-bi...

    ID: 1479469

    Description: epitope description:KSNAATSYINAIINSKSVSD antigen name:UniProt:I6T4P1 host organism:Rattus norvegicus

    Publication: 12595430;

  15. Structure and antigenic activity of rubella E1 glycoprotein synthetic peptides.

    ID: 1479471

    Description: epitope description:VGATPERPRL antigen name:Structural polyprotein host organism:Homo sapiens

    Publication: 1932562;

  16. Bovine coronavirus spike glycoprotein: localization of an immunodominant region at the amino-terminal end of S2.

    ID: 1479616

    Description: epitope description:ITTGYRFTN antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1281870;

  17. Bovine coronavirus spike glycoprotein: localization of an immunodominant region at the amino-terminal end of S2.

    ID: 1479618

    Description: epitope description:TGYRFTNFE antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1281870;

  18. Bovine coronavirus spike glycoprotein: localization of an immunodominant region at the amino-terminal end of S2.

    ID: 1479621

    Description: epitope description:RFTNFEPFT antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1281870;

  19. Bovine coronavirus spike glycoprotein: localization of an immunodominant region at the amino-terminal end of S2.

    ID: 1479625

    Description: epitope description:FEPFTVNSV antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1281870;

  20. Bovine coronavirus spike glycoprotein: localization of an immunodominant region at the amino-terminal end of S2.

    ID: 1479627

    Description: epitope description:PFTVNSVND antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1281870;

  21. Bovine coronavirus spike glycoprotein: localization of an immunodominant region at the amino-terminal end of S2.

    ID: 1479628

    Description: epitope description:FTVNSVNDS antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1281870;

  22. Analysis of peptide mimotopes of Burkholderia pseudomallei exopolysaccharide.

    ID: 1477994

    Description: epitope description:ACYLPFQLSCGGKS host organism:Mus musculus BALB/c antibody name:3VIE5

    Publication: 17935838;

  23. Analysis of peptide mimotopes of Burkholderia pseudomallei exopolysaccharide.

    ID: 1477996

    Description: epitope description:ACYLPFQLSCGGKS host organism:Mus musculus BALB/c

    Publication: 17935838;

  24. Analysis of peptide mimotopes of Burkholderia pseudomallei exopolysaccharide.

    ID: 1477997

    Description: epitope description:ACYLPFQLSCGGKS host organism:Mus musculus BALB/c

    Publication: 17935838;

  25. A detailed mutagenesis study of flavivirus cross-reactive epitopes using West Nile virus-like particles.

    ID: 1478007

    Description: epitope description:G106 antigen name:Genome polyprotein host organism:Mus musculus antibody name:4A1B-9

    Publication: 17374760;

  26. Vaccines prepared from chimeras of foot-and-mouth disease virus (FMDV) induce neutralizing antibodies and protective immunity to multiple serotypes of...

    ID: 1478012

    Description: epitope description:ECRYSRNAVPNLRGDLQVLAQKVART antigen name:Polyprotein host organism:Mus musculus BALB/c antibody name:12FE9

    Publication: 7523697;

  27. Monoclonal antibody to shiga toxin 1, which blocks receptor binding and neutralizes cytotoxicity.

    ID: 1478062

    Description: epitope description:N75 antigen name:Shiga toxin-like subunit B host organism:Mus musculus antibody name:5-5B

    Publication: 12516775;

  28. Vaccines prepared from chimeras of foot-and-mouth disease virus (FMDV) induce neutralizing antibodies and protective immunity to multiple serotypes of...

    ID: 1478067

    Description: epitope description:ECRYSRNAVPNLRGDLQVLAQKVART antigen name:Polyprotein host organism:Cavia porcellus antibody name:Guinea pig sera

    Publication: 7523697;

  29. Vaccines prepared from chimeras of foot-and-mouth disease virus (FMDV) induce neutralizing antibodies and protective immunity to multiple serotypes of...

    ID: 1478070

    Description: epitope description:TGTTTYTTSARRGDLAHLATAHARH antigen name:Polyprotein host organism:Cavia porcellus antibody name:Guinea pig sera

    Publication: 7523697;

  30. Vaccine-induced IgG antibodies to the linear epitope on the PorB outer membrane protein promote opsonophagocytosis of Neisseria meningitidis by human ...

    ID: 1478082

    Description: epitope description:VETSRSVFHQNGQVTEVTTATGI antigen name:Major outer membrane protein P.IB host organism:Homo sapiens antibody name:peptide D63b2-spec...

    Publication: 9191881;

  31. Mapping of epitopes of VP2 protein of chicken anemia virus using monoclonal antibodies.

    ID: 1478090

    Description: epitope description:LEDRSTQASLEEAILR antigen name:Dual specificity protein phosphatase VP2 host organism:Mus musculus BALB/c antibody name:A11G11, F3G...

    Publication: 17481740;

  32. Mapping of epitopes of VP2 protein of chicken anemia virus using monoclonal antibodies.

    ID: 1478109

    Description: epitope description:GQPGPSGAAQGQVISN antigen name:Dual specificity protein phosphatase VP2 host organism:Mus musculus BALB/c

    Publication: 17481740;

  33. Mapping of epitopes of VP2 protein of chicken anemia virus using monoclonal antibodies.

    ID: 1478110

    Description: epitope description:GQPGPSGAAQGQVISN antigen name:Dual specificity protein phosphatase VP2 host organism:Mus musculus BALB/c

    Publication: 17481740;

  34. Mapping of epitopes of VP2 protein of chicken anemia virus using monoclonal antibodies.

    ID: 1478111

    Description: epitope description:LEDRSTQASLEEAILR antigen name:Dual specificity protein phosphatase VP2 host organism:Mus musculus BALB/c

    Publication: 17481740;

  35. Crystal structure of an Fab fragment in complex with a meningococcal serosubtype antigen and a protein G domain.

    ID: 1478116

    Description: epitope description:ANGGASGQVK antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c antibody name:MN14C11.6

    Publication: 10512717;

  36. Establishment of hybrid cell lines producing monoclonal antibodies to a synthetic peptide from the E1 region of the hepatitis C virus.

    ID: 1478125

    Description: epitope description:GHRMAWDMM antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:10C7 and 10B2

    Publication: 18080883;

  37. A single amino acid substitution affects multiple overlapping epitopes in the major antigenic site of foot-and-mouth disease virus of serotype C.

    ID: 1478143

    Description: epitope description:ASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Mus musculus BALB/c antibody name:7FC12, 7AH1, 7EE6

    Publication: 1690261;

  38. A monoclonal antibody (1D12) defines novel distribution patterns of prion protein (PrP) as granules in nucleus.

    ID: 1478150

    Description: epitope description:RPMIHF antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:T2

    Publication: 18068119;

  39. A single amino acid substitution affects multiple overlapping epitopes in the major antigenic site of foot-and-mouth disease virus of serotype C.

    ID: 1478176

    Description: epitope description:LAHLTTTHARHLP antigen name:Polyprotein host organism:Mus musculus BALB/c antibody name:7CA11, 7JD1, 7CA8

    Publication: 1690261;

  40. Topography and immunogenicity of bluetongue virus VP7 epitopes.

    ID: 1478399

    Description: epitope description:ARQPYGFFLETEEVYQPG antigen name:Core protein VP7 host organism:Oryctolagus cuniculus antibody name:OAB

    Publication: 8629938;

  41. Topography and immunogenicity of bluetongue virus VP7 epitopes.

    ID: 1478400

    Description: epitope description:ARQPYGFFLETEEVYQPG antigen name:Core protein VP7 host organism:Oryctolagus cuniculus antibody name:OAB

    Publication: 8629938;

  42. Topography and immunogenicity of bluetongue virus VP7 epitopes.

    ID: 1478405

    Description: epitope description:GVTVSVGGVDMRAGRIIAWDGQAALQIHNPTQQN antigen name:Core protein VP7 host organism:Oryctolagus cuniculus antibody name:Rabbit anti-ser...

    Publication: 8629938;

  43. Topography and immunogenicity of bluetongue virus VP7 epitopes.

    ID: 1478406

    Description: epitope description:QYPALT antigen name:Core protein VP7 host organism:Mus musculus antibody name:20D11, 20F10

    Publication: 8629938;

  44. Characterisation of mouse monoclonal antibodies for pneumolysin: fine epitope mapping and V gene usage.

    ID: 1478418

    Description: epitope description:RPPRYLANQ host organism:Mus musculus BALB/c antibody name:PLY-4

    Publication: 12941482;

  45. Characterisation of mouse monoclonal antibodies for pneumolysin: fine epitope mapping and V gene usage.

    ID: 1478420

    Description: epitope description:RLPRYMQEV host organism:Mus musculus BALB/c antibody name:PLY-4

    Publication: 12941482;

  46. Characterisation of mouse monoclonal antibodies for pneumolysin: fine epitope mapping and V gene usage.

    ID: 1478427

    Description: epitope description:GGQTFTDRE host organism:Mus musculus BALB/c antibody name:PLY-7

    Publication: 12941482;

  47. Efficient neutralization of foot-and-mouth disease virus by monovalent antibody binding.

    ID: 1478436

    Description: epitope description:YTASARGDLAHL antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:SD6

    Publication: 9371652;

  48. Antigenicity of a synthetic peptide from glucosyltransferases of Streptococcus mutans in humans.

    ID: 1478452

    Description: epitope description:ANDVDNSNPVVQAEQLNWL antigen name:UniProt:I6TQ53 host organism:Homo sapiens

    Publication: 9038329;

  49. The conserved undecapeptide shared by thiol-activated cytolysins is involved in membrane binding.

    ID: 1478454

    Description: epitope description:ECTGLAWEWWRT antigen name:Pneumolysin host organism:Mus musculus BALB/c antibody name:PLY-5

    Publication: 10526185;

  50. The conserved undecapeptide shared by thiol-activated cytolysins is involved in membrane binding.

    ID: 1478458

    Description: epitope description:ECTGLAWEWWRT antigen name:Pneumolysin host organism:Mus musculus BALB/c antibody name:PLY-5

    Publication: 10526185;

  51. The conserved undecapeptide shared by thiol-activated cytolysins is involved in membrane binding.

    ID: 1478461

    Description: epitope description:ECTGLAWEWWRT antigen name:Pneumolysin host organism:Mus musculus BALB/c antibody name:PLY-5

    Publication: 10526185;

  52. A dominant B-cell epitope on the 22 kDa tegumental membrane-associated antigen of Schistosoma japonicum maps to an EF-hand calcium binding domain.

    ID: 1478466

    Description: epitope description:MATTEYRLSLMEQFIRAFIE antigen name:Schistosoma japonicum protein host organism:Mus musculus CBA

    Publication: 9292892;

  53. A dominant B-cell epitope on the 22 kDa tegumental membrane-associated antigen of Schistosoma japonicum maps to an EF-hand calcium binding domain.

    ID: 1478470

    Description: epitope description:MATTEYRLSLMEQFIRAFIE antigen name:Schistosoma japonicum protein host organism:Mus musculus BALB/c

    Publication: 9292892;

  54. A dominant B-cell epitope on the 22 kDa tegumental membrane-associated antigen of Schistosoma japonicum maps to an EF-hand calcium binding domain.

    ID: 1478472

    Description: epitope description:MEQFIRAFIEIDKDNNELID antigen name:Schistosoma japonicum protein host organism:Mus musculus CBA

    Publication: 9292892;

  55. A dominant B-cell epitope on the 22 kDa tegumental membrane-associated antigen of Schistosoma japonicum maps to an EF-hand calcium binding domain.

    ID: 1478474

    Description: epitope description:IDKDNNELIDKQELTKYCQQ antigen name:Schistosoma japonicum protein host organism:Mus musculus C57BL/6

    Publication: 9292892;

  56. A dominant B-cell epitope on the 22 kDa tegumental membrane-associated antigen of Schistosoma japonicum maps to an EF-hand calcium binding domain.

    ID: 1478475

    Description: epitope description:IDKDNNELIDKQELTKYCQQ antigen name:Schistosoma japonicum protein host organism:Mus musculus CBA

    Publication: 9292892;

  57. A dominant B-cell epitope on the 22 kDa tegumental membrane-associated antigen of Schistosoma japonicum maps to an EF-hand calcium binding domain.

    ID: 1478486

    Description: epitope description:GKVSLEEFCRGFGLKVWEVR antigen name:Schistosoma japonicum protein host organism:Mus musculus C57BL/6

    Publication: 9292892;

  58. A dominant B-cell epitope on the 22 kDa tegumental membrane-associated antigen of Schistosoma japonicum maps to an EF-hand calcium binding domain.

    ID: 1478489

    Description: epitope description:GFGLKVWEVRREKEELKRDK antigen name:Schistosoma japonicum protein host organism:Mus musculus C57BL/6

    Publication: 9292892;

  59. A dominant B-cell epitope on the 22 kDa tegumental membrane-associated antigen of Schistosoma japonicum maps to an EF-hand calcium binding domain.

    ID: 1478495

    Description: epitope description:EGKVSTLPLDIQIIAATMSK antigen name:Schistosoma japonicum protein host organism:Mus musculus C57BL/6

    Publication: 9292892;

  60. A dominant B-cell epitope on the 22 kDa tegumental membrane-associated antigen of Schistosoma japonicum maps to an EF-hand calcium binding domain.

    ID: 1478498

    Description: epitope description:IQIIAATMSKAKQYNICCKF antigen name:Schistosoma japonicum protein host organism:Mus musculus C57BL/6

    Publication: 9292892;

  61. A dominant B-cell epitope on the 22 kDa tegumental membrane-associated antigen of Schistosoma japonicum maps to an EF-hand calcium binding domain.

    ID: 1478500

    Description: epitope description:IQIIAATMSKAKQYNICCKF antigen name:Schistosoma japonicum protein host organism:Mus musculus BALB/c

    Publication: 9292892;

  62. A dominant B-cell epitope on the 22 kDa tegumental membrane-associated antigen of Schistosoma japonicum maps to an EF-hand calcium binding domain.

    ID: 1478506

    Description: epitope description:KELLDKTSRTGDEVRALAND antigen name:Schistosoma japonicum protein host organism:Mus musculus BALB/c

    Publication: 9292892;

  63. A dominant B-cell epitope on the 22 kDa tegumental membrane-associated antigen of Schistosoma japonicum maps to an EF-hand calcium binding domain.

    ID: 1478510

    Description: epitope description:LKAFLDSEYGRVWQVIILTG antigen name:Schistosoma japonicum protein host organism:Mus musculus C57BL/6

    Publication: 9292892;

  64. A dominant B-cell epitope on the 22 kDa tegumental membrane-associated antigen of Schistosoma japonicum maps to an EF-hand calcium binding domain.

    ID: 1478519

    Description: epitope description:FLSMQFKYSNYVCLLWRTPSS antigen name:Schistosoma japonicum protein host organism:Mus musculus C57BL/6

    Publication: 9292892;

  65. A dominant B-cell epitope on the 22 kDa tegumental membrane-associated antigen of Schistosoma japonicum maps to an EF-hand calcium binding domain.

    ID: 1478520

    Description: epitope description:FLSMQFKYSNYVCLLWRTPSS antigen name:Schistosoma japonicum protein host organism:Mus musculus CBA

    Publication: 9292892;

  66. Neutralization of hemorrhagic snake venom metalloproteinase HR1a from Protobothrops flavoviridis by human monoclonal antibody.

    ID: 1478523

    Description: epitope description:IVNTLNEIYRYLYVR antigen name:Zinc metalloproteinase/disintegrin-like HR1a host organism:Mus musculus HuMAb (Medarex) antibody name...

    Publication: 18061641;

  67. Isolation and characterization of broadly neutralizing human monoclonal antibodies to the e1 glycoprotein of hepatitis C virus.

    ID: 1478531

    Description: epitope description:RMAWDM antigen name:Genome polyprotein host organism:Mus musculus antibody name:IGH209

    Publication: 17977972;

  68. Isolation and characterization of broadly neutralizing human monoclonal antibodies to the e1 glycoprotein of hepatitis C virus.

    ID: 1478559

    Description: epitope description:LTGHRMAWDMMMNWS antigen name:Genome polyprotein host organism:Homo sapiens antibody name:IGH505, IGH526

    Publication: 17977972;

  69. A functional epitope of the pneumococcal surface adhesin A activates nasopharyngeal cells and increases bacterial internalization.

    ID: 1478576

    Description: epitope description:LFVESSVKRRPMKTVSQDTNIPIYAQIF host organism:Oryctolagus cuniculus

    Publication: 17997274;

  70. Mapping of linear B-cell epitopes on the 14-kDa fatty-acid binding protein of Chinese Schistosoma japonicum.

    ID: 1478613

    Description: epitope description:MSSFLGKWKLSESHNFDAVM antigen name:Schistosoma japonicum protein host organism:Mus musculus BALB/c

    Publication: 9512993;

  71. Mapping of linear B-cell epitopes on the 14-kDa fatty-acid binding protein of Chinese Schistosoma japonicum.

    ID: 1478615

    Description: epitope description:MSSFLGKWKLSESHNFDAVM antigen name:Schistosoma japonicum protein host organism:Mus musculus CBA

    Publication: 9512993;

  72. Mapping of linear B-cell epitopes on the 14-kDa fatty-acid binding protein of Chinese Schistosoma japonicum.

    ID: 1478617

    Description: epitope description:SESHNFDAVMSKLGVSWATR antigen name:Schistosoma japonicum protein host organism:Mus musculus CBA

    Publication: 9512993;

  73. Mapping of linear B-cell epitopes on the 14-kDa fatty-acid binding protein of Chinese Schistosoma japonicum.

    ID: 1478619

    Description: epitope description:SESHNFDAVMSKLGVSWATR antigen name:Schistosoma japonicum protein host organism:Mus musculus C57BL/6

    Publication: 9512993;

  74. Mapping of linear B-cell epitopes on the 14-kDa fatty-acid binding protein of Chinese Schistosoma japonicum.

    ID: 1478631

    Description: epitope description:QIGNTVTPTVTFTMDGDTMT antigen name:Schistosoma japonicum protein host organism:Mus musculus C57BL/6

    Publication: 9512993;

  75. Mapping of linear B-cell epitopes on the 14-kDa fatty-acid binding protein of Chinese Schistosoma japonicum.

    ID: 1478633

    Description: epitope description:QIGNTVTPTVTFTMDGDTMT antigen name:Schistosoma japonicum protein host organism:Mus musculus BALB/c

    Publication: 9512993;

  76. Mapping of linear B-cell epitopes on the 14-kDa fatty-acid binding protein of Chinese Schistosoma japonicum.

    ID: 1478634

    Description: epitope description:TFTMDGDTMTMLTESTFKNL antigen name:Schistosoma japonicum protein host organism:Mus musculus C57BL/6

    Publication: 9512993;

  77. Mapping of linear B-cell epitopes on the 14-kDa fatty-acid binding protein of Chinese Schistosoma japonicum.

    ID: 1478635

    Description: epitope description:TFTMDGDTMTMLTESTFKNL antigen name:Schistosoma japonicum protein host organism:Mus musculus CBA

    Publication: 9512993;

  78. Mapping of linear B-cell epitopes on the 14-kDa fatty-acid binding protein of Chinese Schistosoma japonicum.

    ID: 1478636

    Description: epitope description:TFTMDGDTMTMLTESTFKNL antigen name:Schistosoma japonicum protein host organism:Mus musculus BALB/c

    Publication: 9512993;

  79. Mapping of linear B-cell epitopes on the 14-kDa fatty-acid binding protein of Chinese Schistosoma japonicum.

    ID: 1478645

    Description: epitope description:MLTESTFKNLSVTFKFGEEF antigen name:Schistosoma japonicum protein host organism:Mus musculus BALB/c

    Publication: 9512993;

  80. Mapping of linear B-cell epitopes on the 14-kDa fatty-acid binding protein of Chinese Schistosoma japonicum.

    ID: 1478652

    Description: epitope description:DEKTSDGRSVKSVVTKDSES antigen name:Schistosoma japonicum protein host organism:Mus musculus C57BL/6

    Publication: 9512993;

  81. Mapping of linear B-cell epitopes on the 14-kDa fatty-acid binding protein of Chinese Schistosoma japonicum.

    ID: 1478656

    Description: epitope description:DEKTSDGRSVKSVVTKDSES antigen name:Schistosoma japonicum protein host organism:Mus musculus CBA

    Publication: 9512993;

  82. Mapping of linear B-cell epitopes on the 14-kDa fatty-acid binding protein of Chinese Schistosoma japonicum.

    ID: 1478657

    Description: epitope description:DEKTSDGRSVKSVVTKDSES antigen name:Schistosoma japonicum protein host organism:Mus musculus BALB/c

    Publication: 9512993;

  83. Mapping of linear B-cell epitopes on the 14-kDa fatty-acid binding protein of Chinese Schistosoma japonicum.

    ID: 1478663

    Description: epitope description:KSVVTKDSESKITQTQKDSK antigen name:Schistosoma japonicum protein host organism:Mus musculus BALB/c

    Publication: 9512993;

  84. Mapping of linear B-cell epitopes on the 14-kDa fatty-acid binding protein of Chinese Schistosoma japonicum.

    ID: 1478664

    Description: epitope description:KITQTQKDSKNTTVIVREIV antigen name:Schistosoma japonicum protein host organism:Mus musculus C57BL/6

    Publication: 9512993;

  85. Mapping of linear B-cell epitopes on the 14-kDa fatty-acid binding protein of Chinese Schistosoma japonicum.

    ID: 1478665

    Description: epitope description:KITQTQKDSKNTTVIVREIV antigen name:Schistosoma japonicum protein host organism:Mus musculus CBA

    Publication: 9512993;

  86. Mapping of linear B-cell epitopes on the 14-kDa fatty-acid binding protein of Chinese Schistosoma japonicum.

    ID: 1478668

    Description: epitope description:KITQTQKDSKNTTVIVREIV antigen name:Schistosoma japonicum protein host organism:Mus musculus CBA

    Publication: 9512993;

  87. Mapping of linear B-cell epitopes on the 14-kDa fatty-acid binding protein of Chinese Schistosoma japonicum.

    ID: 1478692

    Description: epitope description:GDTMKTTVTVDDVTAIRNYKRL antigen name:Schistosoma japonicum protein host organism:Mus musculus BALB/c

    Publication: 9512993;

  88. A highly conserved epitope on the spike protein of infectious bronchitis virus.

    ID: 1478716

    Description: epitope description:QYNTGNFSDGFYPFIN antigen name:Spike glycoprotein host organism:Gallus gallus antibody name:9B1B6

    Publication: 8572941;

  89. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478722

    Description: epitope description:FFGVAPLAQASQGEG antigen name:Cell surface protein host organism:Capra hircus

    Publication: 15932983;

  90. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478724

    Description: epitope description:QASQGEGNSSTSTVQ antigen name:Cell surface protein host organism:Capra hircus

    Publication: 15932983;

  91. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478726

    Description: epitope description:SSTSTVQGFSSVNIF antigen name:Cell surface protein host organism:Capra hircus

    Publication: 15932983;

  92. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478734

    Description: epitope description:SSAAGGPVAAGGSYS antigen name:Cell surface protein host organism:Capra hircus

    Publication: 15932983;

  93. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478737

    Description: epitope description:AAGGSYSSGDLGKKG antigen name:Cell surface protein host organism:Oncorhynchus tshawytscha antibody name:anti-p57

    Publication: 15932983;

  94. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478744

    Description: epitope description:EQKGSSFVYNKDGPA antigen name:Cell surface protein host organism:Capra hircus

    Publication: 15932983;

  95. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478749

    Description: epitope description:ELKVWGTTLNVGFGC antigen name:Cell surface protein host organism:Oncorhynchus tshawytscha antibody name:anti-p57

    Publication: 15932983;

  96. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478750

    Description: epitope description:LNVGFGCNDNAPSPM antigen name:Cell surface protein host organism:Capra hircus

    Publication: 15932983;

  97. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478753

    Description: epitope description:DNAPSPMGCGPANKP antigen name:Cell surface protein host organism:Oncorhynchus tshawytscha antibody name:anti-p57

    Publication: 15932983;

  98. Mapping of neutralizing epitopes on Renibacterium salmoninarum p57 by use of transposon mutagenesis and synthetic peptides.

    ID: 1478757

    Description: epitope description:ASGLQPPAGPLGGGT antigen name:Cell surface protein host organism:Oncorhynchus tshawytscha antibody name:anti-p57

    Publication: 15932983;

  99. Location and primary structure of a major antigenic site for poliovirus neutralization.

    ID: 1480424

    Description: epitope description:T97 antigen name:Genome polyprotein host organism:Rattus norvegicus antibody name:27-4-4

    Publication: 6186919;

  100. Location and primary structure of a major antigenic site for poliovirus neutralization.

    ID: 1480426

    Description: epitope description:R98 antigen name:Genome polyprotein host organism:Rattus norvegicus antibody name:25-1-14, 25-4-12, 25-5-5, 27-4-4

    Publication: 6186919;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston