Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1589195

    Description: epitope description:PNSWYGAGAIKMSGPNNHV antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  2. Extensive antigenic polymorphism within the repeat sequence of the Plasmodium falciparum merozoite surface protein 1 block 2 is incorporated in a mini...

    ID: 1589218

    Description: epitope description:SAQSGASAQSGA antigen name:Merozoite surface protein 1 host organism:Mus musculus antibody name:12.2

    Publication: 16113313;

  3. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1589234

    Description: epitope description:KVTKEKPTPP antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  4. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1589237

    Description: epitope description:KEKPTPPVKP antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  5. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1589242

    Description: epitope description:PPVKPTAPTK antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  6. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1589248

    Description: epitope description:TAPTKPTYET antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  7. Mapping of epitopes on the fiber knobs of human adenovirus serotypes 8 and 15.

    ID: 1589368

    Description: epitope description:DSKLTLILTKCGSQI antigen name:fiber (GenPept:190341006) host organism:Oryctolagus cuniculus

    Publication: 11937773;

  8. Identification of neutralizing epitopes on Pseudomonas aeruginosa elastase and effects of cross-reactions on other thermolysin-like proteases.

    ID: 1589457

    Description: epitope description:HGFTEQNSG antigen name:Elastase host organism:Mus musculus BALB/c antibody name:36-6-6, 36-6-8

    Publication: 9009299;

  9. Identification of neutralizing epitopes on Pseudomonas aeruginosa elastase and effects of cross-reactions on other thermolysin-like proteases.

    ID: 1589458

    Description: epitope description:RYMDQPSRD antigen name:Elastase host organism:Mus musculus BALB/c antibody name:36-6-6, 36-6-8

    Publication: 9009299;

  10. Identification of neutralizing epitopes on Pseudomonas aeruginosa elastase and effects of cross-reactions on other thermolysin-like proteases.

    ID: 1589465

    Description: epitope description:HGFTEQNSG antigen name:Elastase host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9009299;

  11. Identification of neutralizing epitopes on Pseudomonas aeruginosa elastase and effects of cross-reactions on other thermolysin-like proteases.

    ID: 1589467

    Description: epitope description:RYMDQPSRD antigen name:Elastase host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9009299;

  12. Identification of neutralizing epitopes on Pseudomonas aeruginosa elastase and effects of cross-reactions on other thermolysin-like proteases.

    ID: 1589478

    Description: epitope description:HGFTEQNSG antigen name:Elastase host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9009299;

  13. Epitope mapping and affinity purification of monospecific antibodies by Escherichia coli cell surface display of gene-derived random peptide libraries...

    ID: 1589496

    Description: epitope description:CRYDKNTDVNV antigen name:Genome polyprotein host organism:Mus musculus antibody name:24/16

    Publication: 11687250;

  14. Mapping of a fusion related epitope of the respiratory syncytial virus fusion protein.

    ID: 1589506

    Description: epitope description:SKVLHLEGEVNKIKS antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 1711741;

  15. Mapping of a fusion related epitope of the respiratory syncytial virus fusion protein.

    ID: 1589507

    Description: epitope description:SKVLHLEGEVNKIKS antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 1711741;

  16. Mapping of a fusion related epitope of the respiratory syncytial virus fusion protein.

    ID: 1589513

    Description: epitope description:INDMPITNDQKKL antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 1711741;

  17. Mapping of a fusion related epitope of the respiratory syncytial virus fusion protein.

    ID: 1589515

    Description: epitope description:PLCTTNTKEGSNICLTRTDRG antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 1711741;

  18. Mapping of a fusion related epitope of the respiratory syncytial virus fusion protein.

    ID: 1589516

    Description: epitope description:QQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWK antigen name:Fusion glycoprotein F0 host organism:Mus musculus antibody name:L4

    Publication: 1711741;

  19. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1590059

    Description: epitope description:QTELARVQKA antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  20. Analysis of the IgE-epitope of Der f 2, a major mite allergen, by in vitro mutagenesis.

    ID: 1590061

    Description: epitope description:IATHAKIRD antigen name:Der f 2 host organism:Homo sapiens

    Publication: 8544851;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston