Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Fine specificity of monoclonal antibodies against celiac disease-inducing peptides in the gluteome.

    ID: 1605536

    Description: epitope description:QGQQGYYP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musculus BALB/c antibody name...

    Publication: 18842794;

  2. Antibodies raised in a natural host and monoclonal antibodies recognize similar antigenic features of foot-and-mouth disease virus.

    ID: 1605604

    Description: epitope description:ASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Mus musculus antibody name:7JD1, 7FC12, 7AH1, 7CA11

    Publication: 7793064;

  3. Peptide mimicking antigenic and immunogenic epitope of neuwiedase from Bothrops neuwiedi snake venom.

    ID: 1605660

    Description: epitope description:TTLNSFMRSFPP host organism:Oryctolagus cuniculus

    Publication: 19084031;

  4. Peptide mimicking antigenic and immunogenic epitope of neuwiedase from Bothrops neuwiedi snake venom.

    ID: 1605668

    Description: epitope description:ELNTFFRWTTGG host organism:Oryctolagus cuniculus

    Publication: 19084031;

  5. Peptide mimicking antigenic and immunogenic epitope of neuwiedase from Bothrops neuwiedi snake venom.

    ID: 1605694

    Description: epitope description:TLNDFFHNPPHP host organism:Oryctolagus cuniculus

    Publication: 19084031;

  6. Peptide mimicking antigenic and immunogenic epitope of neuwiedase from Bothrops neuwiedi snake venom.

    ID: 1605699

    Description: epitope description:SLNOFFMTSSPA host organism:Oryctolagus cuniculus

    Publication: 19084031;

  7. Antigenic determinants of the chlamydial major outer membrane protein resolved at a single amino acid level.

    ID: 1605706

    Description: epitope description:SDSKL antigen name:Major outer membrane porin, serovar D host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1705241;

  8. Structural and immunological analysis of circumsporozoite protein peptides: a further step in the identification of potential components of a minimal ...

    ID: 1605729

    Description: epitope description:NSRSLGENDDGNNEDGEKLR host organism:Aotus nancymaae

    Publication: 18930095;

  9. Structural and immunological analysis of circumsporozoite protein peptides: a further step in the identification of potential components of a minimal ...

    ID: 1605731

    Description: epitope description:NSRGLGENDDGGNEDNEKLR host organism:Aotus nancymaae

    Publication: 18930095;

  10. Structural and immunological analysis of circumsporozoite protein peptides: a further step in the identification of potential components of a minimal ...

    ID: 1605733

    Description: epitope description:KLSFAHGENDDGNN host organism:Aotus nancymaae

    Publication: 18930095;

  11. Structural and immunological analysis of circumsporozoite protein peptides: a further step in the identification of potential components of a minimal ...

    ID: 1605734

    Description: epitope description:KISFAHGENDDGNN host organism:Aotus nancymaae

    Publication: 18930095;

  12. Sequential B-cell epitopes of Bacillus anthracis lethal factor bind lethal toxin-neutralizing antibodies.

    ID: 1605752

    Description: epitope description:HGDVGMHVKE antigen name:Lethal factor host organism:Mus musculus A/J

    Publication: 18981257;

  13. Sequential B-cell epitopes of Bacillus anthracis lethal factor bind lethal toxin-neutralizing antibodies.

    ID: 1605754

    Description: epitope description:LIKKVTNYLV antigen name:Lethal factor host organism:Mus musculus A/J

    Publication: 18981257;

  14. Sequential B-cell epitopes of Bacillus anthracis lethal factor bind lethal toxin-neutralizing antibodies.

    ID: 1605756

    Description: epitope description:NYLVDGNGRF antigen name:Lethal factor host organism:Mus musculus A/J

    Publication: 18981257;

  15. Sequential B-cell epitopes of Bacillus anthracis lethal factor bind lethal toxin-neutralizing antibodies.

    ID: 1605757

    Description: epitope description:LVDGNGRFVF antigen name:Lethal factor host organism:Mus musculus A/J

    Publication: 18981257;

  16. Sequential B-cell epitopes of Bacillus anthracis lethal factor bind lethal toxin-neutralizing antibodies.

    ID: 1605762

    Description: epitope description:VTNYLVDGNG antigen name:Lethal factor host organism:Mus musculus C57BL/6 X BALB/c antibody name:9A11

    Publication: 18981257;

  17. Sequential B-cell epitopes of Bacillus anthracis lethal factor bind lethal toxin-neutralizing antibodies.

    ID: 1605763

    Description: epitope description:VTNYLVDGNG antigen name:Lethal factor host organism:Mus musculus C57BL/6 X BALB/c antibody name:9A11

    Publication: 18981257;

  18. Sequential B-cell epitopes of Bacillus anthracis lethal factor bind lethal toxin-neutralizing antibodies.

    ID: 1605764

    Description: epitope description:VTNYLVDGNG antigen name:Lethal factor host organism:Mus musculus C57BL/6 X BALB/c antibody name:9A11

    Publication: 18981257;

  19. Sequential B-cell epitopes of Bacillus anthracis lethal factor bind lethal toxin-neutralizing antibodies.

    ID: 1605780

    Description: epitope description:QDLLFTNQLK antigen name:Lethal factor host organism:Mus musculus A/J

    Publication: 18981257;

  20. Sequential B-cell epitopes of Bacillus anthracis lethal factor bind lethal toxin-neutralizing antibodies.

    ID: 1605787

    Description: epitope description:DFSVEFLEQN antigen name:Lethal factor host organism:Mus musculus A/J

    Publication: 18981257;

  21. Sequential B-cell epitopes of Bacillus anthracis lethal factor bind lethal toxin-neutralizing antibodies.

    ID: 1605791

    Description: epitope description:NSKKFIDIFK antigen name:Lethal factor host organism:Mus musculus A/J

    Publication: 18981257;

  22. Sequential B-cell epitopes of Bacillus anthracis lethal factor bind lethal toxin-neutralizing antibodies.

    ID: 1605798

    Description: epitope description:VLQLYAPEAF antigen name:Lethal factor host organism:Mus musculus A/J

    Publication: 18981257;

  23. Sequential B-cell epitopes of Bacillus anthracis lethal factor bind lethal toxin-neutralizing antibodies.

    ID: 1605803

    Description: epitope description:NYMDKFNEQE antigen name:Lethal factor host organism:Mus musculus A/J

    Publication: 18981257;

  24. Sequential B-cell epitopes of Bacillus anthracis lethal factor bind lethal toxin-neutralizing antibodies.

    ID: 1605810

    Description: epitope description:LEELKDQRML antigen name:Lethal factor host organism:Mus musculus A/J

    Publication: 18981257;

  25. Sequential B-cell epitopes of Bacillus anthracis lethal factor bind lethal toxin-neutralizing antibodies.

    ID: 1605812

    Description: epitope description:SEEEKELLNR antigen name:Lethal factor host organism:Mus musculus A/J

    Publication: 18981257;

  26. Sequential B-cell epitopes of Bacillus anthracis lethal factor bind lethal toxin-neutralizing antibodies.

    ID: 1605819

    Description: epitope description:DSPSINLDVR antigen name:Lethal factor host organism:Mus musculus A/J

    Publication: 18981257;

  27. Sequential B-cell epitopes of Bacillus anthracis lethal factor bind lethal toxin-neutralizing antibodies.

    ID: 1605824

    Description: epitope description:EERNKTQEEH antigen name:Lethal factor host organism:Mus musculus A/J

    Publication: 18981257;

  28. Sequential B-cell epitopes of Bacillus anthracis lethal factor bind lethal toxin-neutralizing antibodies.

    ID: 1605831

    Description: epitope description:YGKDALLHEH antigen name:Lethal factor host organism:Mus musculus A/J

    Publication: 18981257;

  29. Sequential B-cell epitopes of Bacillus anthracis lethal factor bind lethal toxin-neutralizing antibodies.

    ID: 1605832

    Description: epitope description:KDALLHEHYV antigen name:Lethal factor host organism:Mus musculus A/J

    Publication: 18981257;

  30. Sequential B-cell epitopes of Bacillus anthracis lethal factor bind lethal toxin-neutralizing antibodies.

    ID: 1605841

    Description: epitope description:QYTHQDEIYE antigen name:Lethal factor host organism:Mus musculus A/J

    Publication: 18981257;

  31. Recombinant peptide replicates immunogenicity of synthetic linear peptide chimera for use as pre-erythrocytic stage malaria vaccine.

    ID: 1603958

    Description: epitope description:KQISSQLTEEWSQGPGAPQGPGAPQGPGAPSYVPSAEQI host organism:Mus musculus BALB/c X A/J

    Publication: 19015042;

  32. Recombinant peptide replicates immunogenicity of synthetic linear peptide chimera for use as pre-erythrocytic stage malaria vaccine.

    ID: 1603959

    Description: epitope description:KQISSQLTEEWSQGPGAPQGPGAPQGPGAPSYVPSAEQI host organism:Mus musculus BALB/c

    Publication: 19015042;

  33. Fine specificity of monoclonal antibodies against celiac disease-inducing peptides in the gluteome.

    ID: 1604013

    Description: epitope description:RPQQPYP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musculus BALB/c antibody name:...

    Publication: 18842794;

  34. Fine specificity of monoclonal antibodies against celiac disease-inducing peptides in the gluteome.

    ID: 1604017

    Description: epitope description:PPFSQQ antigen name:Uncharacterized protein (UniProt:Q8W3V4) host organism:Mus musculus BALB/c antibody name:anti-LMW-1 glt

    Publication: 18842794;

  35. Antigenic determinants of the chlamydial major outer membrane protein resolved at a single amino acid level.

    ID: 1604103

    Description: epitope description:LTARE antigen name:Major outer membrane porin, serovar D host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1705241;

  36. Antigenic determinants of the chlamydial major outer membrane protein resolved at a single amino acid level.

    ID: 1604107

    Description: epitope description:AETIF antigen name:Major outer membrane porin, serovar D host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1705241;

  37. Antigenic determinants of the chlamydial major outer membrane protein resolved at a single amino acid level.

    ID: 1604110

    Description: epitope description:TIAGAG antigen name:Major outer membrane porin, serovar D host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1705241;

  38. Antigenic determinants of the chlamydial major outer membrane protein resolved at a single amino acid level.

    ID: 1604132

    Description: epitope description:EFPLD host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1705241;

  39. Antigenic determinants of the chlamydial major outer membrane protein resolved at a single amino acid level.

    ID: 1604136

    Description: epitope description:LENDP host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1705241;

  40. Antigenic determinants of the chlamydial major outer membrane protein resolved at a single amino acid level.

    ID: 1604140

    Description: epitope description:ILDVTT host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1705241;

  41. Antigenic determinants of the chlamydial major outer membrane protein resolved at a single amino acid level.

    ID: 1604143

    Description: epitope description:SAE host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1705241;

  42. Change of antigenic and neutralizing specificity in substitutional epitope peptides of hemophilia B inhibitor.

    ID: 1604158

    Description: epitope description:VNSTEAETI antigen name:Coagulation factor IX host organism:Homo sapiens

    Publication: 9786161;

  43. Murine B-cell and T-cell epitopes of the allergen Hev b 5 from natural rubber latex.

    ID: 1604189

    Description: epitope description:EKAEEVEK antigen name:Hev b 5 host organism:Mus musculus BALB/c

    Publication: 10378685;

  44. Murine B-cell and T-cell epitopes of the allergen Hev b 5 from natural rubber latex.

    ID: 1604204

    Description: epitope description:TETEAPAA antigen name:Hev b 5 host organism:Mus musculus BALB/c

    Publication: 10378685;

  45. Murine B-cell and T-cell epitopes of the allergen Hev b 5 from natural rubber latex.

    ID: 1604206

    Description: epitope description:AAPAEGEK antigen name:Hev b 5 host organism:Mus musculus BALB/c

    Publication: 10378685;

  46. Murine B-cell and T-cell epitopes of the allergen Hev b 5 from natural rubber latex.

    ID: 1604208

    Description: epitope description:EKPAEEEK antigen name:Hev b 5 host organism:Mus musculus BALB/c

    Publication: 10378685;

  47. Murine B-cell and T-cell epitopes of the allergen Hev b 5 from natural rubber latex.

    ID: 1604210

    Description: epitope description:EKPITEAA antigen name:Hev b 5 host organism:Mus musculus BALB/c

    Publication: 10378685;

  48. Murine B-cell and T-cell epitopes of the allergen Hev b 5 from natural rubber latex.

    ID: 1604211

    Description: epitope description:ITEAAETA antigen name:Hev b 5 host organism:Mus musculus BALB/c

    Publication: 10378685;

  49. Murine B-cell and T-cell epitopes of the allergen Hev b 5 from natural rubber latex.

    ID: 1604222

    Description: epitope description:PETEKAEEVEKIEKTEEPAP antigen name:Hev b 5 host organism:Mus musculus BALB/c

    Publication: 10378685;

  50. Systematic epitope analysis of the p26 EIAV core protein.

    ID: 1604289

    Description: epitope description:GLLNEASQNLFGILS antigen name:gag protein host organism:Equus caballus

    Publication: 17705340;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston