Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

ID: 1379530

Description: epitope description:GPPAAEYGPPAAEY host organism:Oryctolagus cuniculus New Zealand White

Recognition of synthetic 104-mer and 102-mer peptides corresponding to N- and C-terminal nonrepeat regions of the Plasmodium falciparum circumsporozoi...

ID: 1379535

Description: epitope description:DNAGTNLYNELEMNYYGKQENWYSLKKNSRSLGENDDGNNN antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:Huma...

Recognition of synthetic 104-mer and 102-mer peptides corresponding to N- and C-terminal nonrepeat regions of the Plasmodium falciparum circumsporozoi...

ID: 1379537

Description: epitope description:KNNQGNGQGHNMPNDPNRNVDENANANN antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:Human sera

Recognition of synthetic 104-mer and 102-mer peptides corresponding to N- and C-terminal nonrepeat regions of the Plasmodium falciparum circumsporozoi...

ID: 1379538

Description: epitope description:NAVKNNNNEEPSDKHIEQYLKKIKNSISTEW antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:Human sera

Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

ID: 1379539

Description: epitope description:TPQGRPVAEYW antigen name:HLA class II histocompatibility antigen, DQ beta 1 chain (UniProt:P01920) host organism:Homo sapiens