Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Epitope mapping of the outer structural protein VP1 of three different serotypes of foot-and-mouth disease virus.

    ID: 1619119

    Description: epitope description:TYTAST antigen name:Polyprotein host organism:Oryctolagus cuniculus

    Publication: 2418582;

  2. Epitope mapping of the outer structural protein VP1 of three different serotypes of foot-and-mouth disease virus.

    ID: 1619133

    Description: epitope description:TATHAR antigen name:Polyprotein host organism:Oryctolagus cuniculus

    Publication: 2418582;

  3. Epitope mapping of the outer structural protein VP1 of three different serotypes of foot-and-mouth disease virus.

    ID: 1619137

    Description: epitope description:HARHLP antigen name:Polyprotein host organism:Oryctolagus cuniculus

    Publication: 2418582;

  4. Epitope mapping of the outer structural protein VP1 of three different serotypes of foot-and-mouth disease virus.

    ID: 1619138

    Description: epitope description:ARHLPT antigen name:Polyprotein host organism:Oryctolagus cuniculus

    Publication: 2418582;

  5. Epitope mapping of the outer structural protein VP1 of three different serotypes of foot-and-mouth disease virus.

    ID: 1619140

    Description: epitope description:HLPTSF antigen name:Polyprotein host organism:Oryctolagus cuniculus

    Publication: 2418582;

  6. Epitope mapping of the outer structural protein VP1 of three different serotypes of foot-and-mouth disease virus.

    ID: 1619142

    Description: epitope description:PTSFNF antigen name:Polyprotein host organism:Oryctolagus cuniculus

    Publication: 2418582;

  7. Epitope mapping of the outer structural protein VP1 of three different serotypes of foot-and-mouth disease virus.

    ID: 1619147

    Description: epitope description:NFGAVK antigen name:Polyprotein host organism:Oryctolagus cuniculus

    Publication: 2418582;

  8. Epitope mapping of the outer structural protein VP1 of three different serotypes of foot-and-mouth disease virus.

    ID: 1619150

    Description: epitope description:AVKAET antigen name:Polyprotein host organism:Oryctolagus cuniculus

    Publication: 2418582;

  9. Epitope mapping of the outer structural protein VP1 of three different serotypes of foot-and-mouth disease virus.

    ID: 1619151

    Description: epitope description:VKAETI antigen name:Polyprotein host organism:Oryctolagus cuniculus

    Publication: 2418582;

  10. Conformation-dependent GAD65 autoantibodies in diabetes.

    ID: 1617338

    Description: epitope description:VTWNPHKMMGVPLQC antigen name:Glutamate decarboxylase 2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15365614;

  11. Identification of neutralization and diagnostic epitopes on PIM, the polymorphic immunodominant molecule of Theileria parva.

    ID: 1617507

    Description: epitope description:DLNPLDPLAQQS antigen name:Membrane protein host organism:Mus musculus antibody name:13

    Publication: 8613398;

  12. Identification of neutralization and diagnostic epitopes on PIM, the polymorphic immunodominant molecule of Theileria parva.

    ID: 1617512

    Description: epitope description:GNNNDSTGSSDV antigen name:Membrane protein host organism:Mus musculus antibody name:8

    Publication: 8613398;

  13. Identification of neutralization and diagnostic epitopes on PIM, the polymorphic immunodominant molecule of Theileria parva.

    ID: 1617538

    Description: epitope description:DQPDQHQ antigen name:Membrane protein host organism:Mus musculus antibody name:IL-S34.3, IL-S36.5

    Publication: 8613398;

  14. Identification of neutralization and diagnostic epitopes on PIM, the polymorphic immunodominant molecule of Theileria parva.

    ID: 1617545

    Description: epitope description:PVYQQQPVQQPS antigen name:Membrane protein host organism:Mus musculus antibody name:8

    Publication: 8613398;

  15. Identification of neutralization and diagnostic epitopes on PIM, the polymorphic immunodominant molecule of Theileria parva.

    ID: 1617551

    Description: epitope description:PVYQQQPVQQPS antigen name:Membrane protein host organism:Mus musculus antibody name:12

    Publication: 8613398;

  16. Identification of neutralization and diagnostic epitopes on PIM, the polymorphic immunodominant molecule of Theileria parva.

    ID: 1617569

    Description: epitope description:QPVQQPSGQQQQ antigen name:Membrane protein host organism:Mus musculus antibody name:8

    Publication: 8613398;

  17. Identification of neutralization and diagnostic epitopes on PIM, the polymorphic immunodominant molecule of Theileria parva.

    ID: 1617573

    Description: epitope description:PEPVQEP antigen name:Membrane protein host organism:Mus musculus antibody name:12

    Publication: 8613398;

  18. Identification of neutralization and diagnostic epitopes on PIM, the polymorphic immunodominant molecule of Theileria parva.

    ID: 1617587

    Description: epitope description:PVYQQQP antigen name:Membrane protein host organism:Mus musculus antibody name:IL-S34.3

    Publication: 8613398;

  19. Identification of neutralization and diagnostic epitopes on PIM, the polymorphic immunodominant molecule of Theileria parva.

    ID: 1617597

    Description: epitope description:DPLAQQS antigen name:Membrane protein host organism:Mus musculus antibody name:IL-S40.2

    Publication: 8613398;

  20. Cross-reactive and serospecific epitopes of nucleocapsid proteins of three hantaviruses: prospects for new diagnostic tools.

    ID: 1617830

    Description: epitope description:H14, E15, G16, Q17, R22, Q23, K24, K26, D35, P36, D37, D38 antigen name:Seoul orthohantavirus protein host organism:Homo sapiens

    Publication: 18620010;

  21. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1617842

    Description: epitope description:ANAANEADYQAKLTAYQTE antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 1370433;

  22. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1617843

    Description: epitope description:ANAANEADYQAKLTAYQTE antigen name:UniProt:I6TX52 host organism:Mus musculus B10.BR

    Publication: 1370433;

  23. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1617863

    Description: epitope description:ANAANEADYQ antigen name:UniProt:I6TX52 host organism:Mus musculus B10.BR

    Publication: 1370433;

  24. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1617870

    Description: epitope description:NAANEADYQA antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 1370433;

  25. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1617879

    Description: epitope description:ADYQAKLTAY antigen name:UniProt:I6TX52 host organism:Mus musculus B10.G

    Publication: 1370433;

  26. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1617881

    Description: epitope description:DYQAKLTAYQ antigen name:UniProt:I6TX52 host organism:Mus musculus B10.G

    Publication: 1370433;

  27. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1617882

    Description: epitope description:DYQAKLTAYQ antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 1370433;

  28. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1617888

    Description: epitope description:TKVVGTQTGN antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 1370433;

  29. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1617900

    Description: epitope description:ELARVQKANA antigen name:UniProt:I6TX52 host organism:Mus musculus B10.G

    Publication: 1370433;

  30. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1617908

    Description: epitope description:LERGQSATAT antigen name:UniProt:I6TX52 host organism:Mus musculus B10.G

    Publication: 1370433;

  31. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1617909

    Description: epitope description:YTNLQNSYYN antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 1370433;

  32. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1617912

    Description: epitope description:DPTLGVFASA antigen name:UniProt:I6TX52 host organism:Mus musculus B10.S

    Publication: 1370433;

  33. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1617927

    Description: epitope description:TPPTRTPDQA antigen name:UniProt:I6TX52 host organism:Mus musculus B10.S

    Publication: 1370433;

  34. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1617928

    Description: epitope description:TPPTRTPDQA antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 1370433;

  35. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1617930

    Description: epitope description:ETEKPLEPAP antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 1370433;

  36. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1617931

    Description: epitope description:VEPSYEAEPT antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 1370433;

  37. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1617933

    Description: epitope description:TEKPLEPAPV antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 1370433;

  38. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1617937

    Description: epitope description:QDLPTPPSDP antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 1370433;

  39. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1617941

    Description: epitope description:KQMGQTGGSY antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 1370433;

  40. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1617945

    Description: epitope description:YIQMKRIAVG antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 1370433;

  41. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1617948

    Description: epitope description:NGVTYSSNTV antigen name:UniProt:I6TX52 host organism:Mus musculus B10.G

    Publication: 1370433;

  42. Transcutaneous beta-amyloid immunization reduces cerebral beta-amyloid deposits without T cell infiltration and microhemorrhage.

    ID: 1617953

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus APPsw

    Publication: 17264212;

  43. Structural and immunological analysis of circumsporozoite protein peptides: a further step in the identification of potential components of a minimal ...

    ID: 1618200

    Description: epitope description:GNGQGHNMPNDPNRNVDENA antigen name:Circumsporozoite (CS) protein host organism:Aotus nancymaae

    Publication: 18930095;

  44. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1618618

    Description: epitope description:PATNLPEAQG antigen name:UniProt:I6TX52 host organism:Mus musculus B10.G

    Publication: 1370433;

  45. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1618621

    Description: epitope description:IEVPKTDLDQ antigen name:UniProt:I6TX52 host organism:Mus musculus B10.G

    Publication: 1370433;

  46. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1618633

    Description: epitope description:KRVQEANAAA antigen name:UniProt:I6TX52 host organism:Mus musculus B10.G

    Publication: 1370433;

  47. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1618639

    Description: epitope description:QEANAANEAD antigen name:UniProt:I6TX52 host organism:Mus musculus B10.G

    Publication: 1370433;

  48. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1618652

    Description: epitope description:EAKLAKYQAD antigen name:UniProt:I6TX52 host organism:Mus musculus B10.G

    Publication: 1370433;

  49. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1618657

    Description: epitope description:VYDLEPNANL antigen name:UniProt:I6TX52 host organism:Mus musculus B10.G

    Publication: 1370433;

  50. Genetic control of immune responses in mice to synthetic peptides of a Streptococcus mutans surface protein antigen.

    ID: 1618658

    Description: epitope description:SLTTDGKFLK antigen name:UniProt:I6TX52 host organism:Mus musculus B10.G

    Publication: 1370433;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston