Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588043

    Description: epitope description:LRLQCKDKENGD antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  2. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588049

    Description: epitope description:DKENGDVTFTEV antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  3. Characterization of Mengo virus neutralization epitopes.

    ID: 1588053

    Description: epitope description:K212, K285 antigen name:Cardiovirus A protein host organism:Mus musculus BALB/c antibody name:mAB6

    Publication: 1704653;

  4. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588054

    Description: epitope description:ENGDVTFTEVGY antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  5. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588066

    Description: epitope description:TRAEGLYSMLVE antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  6. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588076

    Description: epitope description:MLVERDHKNEFC antigen name:Ole e 1 host organism:Oryctolagus cuniculus

    Publication: 15941589;

  7. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588077

    Description: epitope description:VERDHKNEFCEI antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  8. Epitopes of an influenza viral peptide recognized by antibody at single amino acid resolution.

    ID: 1588085

    Description: epitope description:NVPEKQT antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:1/1

    Publication: 2447184;

  9. Epitopes of an influenza viral peptide recognized by antibody at single amino acid resolution.

    ID: 1588086

    Description: epitope description:CPKYV antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 2447184;

  10. Epitopes of an influenza viral peptide recognized by antibody at single amino acid resolution.

    ID: 1588100

    Description: epitope description:GMRNV antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 2447184;

  11. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588109

    Description: epitope description:NEFCEITLISSG antigen name:Ole e 1 host organism:Oryctolagus cuniculus

    Publication: 15941589;

  12. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588112

    Description: epitope description:EITLISSGRKDC antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  13. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588116

    Description: epitope description:ISSGRKDCNEIP antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  14. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588122

    Description: epitope description:DCNEIPTEGWVK antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  15. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588135

    Description: epitope description:PSLKFILNTVNG antigen name:Ole e 1 host organism:Oryctolagus cuniculus

    Publication: 15941589;

  16. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588138

    Description: epitope description:FILNTVNGTTRT antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  17. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588139

    Description: epitope description:FILNTVNGTTRT antigen name:Ole e 1 host organism:Oryctolagus cuniculus

    Publication: 15941589;

  18. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588160

    Description: epitope description:ALPKCAQVYNKL antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  19. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588183

    Description: epitope description:DKENGDVTFTEVGYTRAEGLYSMLVERDHKNE antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  20. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588190

    Description: epitope description:EDVPQPPVSQFHIQGQVYCDTCRAG antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston