Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481087

    Description: epitope description:NNEMDETINKLKKDINKLNEKIEKYDNFMKM antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Ho...

    Publication: 17653272;

  2. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481090

    Description: epitope description:NNVIRSKMYNIKKRISKINDELHELSNFFL antigen name:Uncharacterized protein PFB0460c host organism:Homo sapiens antibody name:Human sera

    Publication: 17653272;

  3. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481093

    Description: epitope description:TYTLSKLNNQINELTKKINILRGNLDKARK antigen name:Uncharacterized protein PFL1235c host organism:Homo sapiens antibody name:Human sera

    Publication: 17653272;

  4. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481108

    Description: epitope description:KLEEMKQKNKELINNLNDISDELKNCIEQVNSVSRNMANVEK antigen name:Uncharacterized protein PFB0765w host organism:Homo sapiens antibody name:...

    Publication: 17653272;

  5. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481110

    Description: epitope description:TLIDSFNLNLSYLRESINNKKKHINKIND antigen name:RING finger protein PFE0100w host organism:Homo sapiens antibody name:Human sera

    Publication: 17653272;

  6. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481112

    Description: epitope description:EKLYILEKSINKLKKLLNDINNKYQTIKK antigen name:Reticulocyte-binding protein 3 host organism:Homo sapiens antibody name:Human sera

    Publication: 17653272;

  7. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481123

    Description: epitope description:NVLEYAELIIDRQRDKINELEKKLEELRSSSEELQKNVIK antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host or...

    Publication: 17653272;

  8. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481124

    Description: epitope description:NVLEYAELIIDRQRDKINELEKKLEELRSSSEELQKNVIK antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host or...

    Publication: 17653272;

  9. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481126

    Description: epitope description:GIFIYNMNLLREILKLMTDNIDTLKDKINEIKCSYAFLK antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host org...

    Publication: 17653272;

  10. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481127

    Description: epitope description:NFVNNYINENILNLKSVDNYLEKINNKIKDLDDNINDR antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host orga...

    Publication: 17653272;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston