Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Proliferative lymphocyte responses to foot-and-mouth disease virus and three FMDV peptides after vaccination or immunization with these peptides in ca...

    ID: 1462785

    Description: epitope description:SRRGDLGSLATRVATQ antigen name:Polyprotein host organism:Bos taurus Friesian

    Publication: 1349300;

  2. Humoral immune response to the E7 protein of bovine papillomavirus type 4 and identification of B-cell epitopes.

    ID: 1462818

    Description: epitope description:LCAACSKQVFCNRRPERNGP antigen name:Protein E7 host organism:Bos taurus antibody name:Bovine Serum

    Publication: 7510442;

  3. IgA antibodies of coeliac disease patients recognise a dominant T cell epitope of A-gliadin.

    ID: 1462896

    Description: epitope description:QLQPFPQP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15306584;

  4. IgA antibodies of coeliac disease patients recognise a dominant T cell epitope of A-gliadin.

    ID: 1462901

    Description: epitope description:PQPELPYP antigen name:Tri a 21 host organism:Homo sapiens

    Publication: 15306584;

  5. Preparation and characterization of monoclonal antibody against abalone allergen tropomyosin.

    ID: 1462905

    Description: epitope description:L99, K149, R160 antigen name:Tropomyosin host organism:Mus musculus BALB/c antibody name:MAb AE9F9

    Publication: 15684662;

  6. Sequence analysis of Pasteurella multocida major outer membrane protein (OmpH) and application of synthetic peptides in vaccination of chickens agains...

    ID: 1462911

    Description: epitope description:SKNVPVQVKDQQGEVVREYEVEKLGNNVHV antigen name:Other Pasteurella multocida protein host organism:Gallus gallus antibody name:Chicken ...

    Publication: 10067687;

  7. Sequence analysis of Pasteurella multocida major outer membrane protein (OmpH) and application of synthetic peptides in vaccination of chickens agains...

    ID: 1462912

    Description: epitope description:KYVKQEVEQNPPAAQKVFKDEK antigen name:Other Pasteurella multocida protein host organism:Gallus gallus antibody name:Chicken sera

    Publication: 10067687;

  8. Ability of synthetic peptides representing epitopes of outer membrane protein F of Pseudomonas aeruginosa to afford protection against P. aeruginosa i...

    ID: 1462956

    Description: epitope description:TDAYNQKLSERRAN antigen name:Outer membrane porin F host organism:Mus musculus ICR

    Publication: 8701588;

  9. Ability of synthetic peptides representing epitopes of outer membrane protein F of Pseudomonas aeruginosa to afford protection against P. aeruginosa i...

    ID: 1462961

    Description: epitope description:NATAEGRAINRRVE antigen name:Outer membrane porin F host organism:Mus musculus ICR

    Publication: 8701588;

  10. A recombinant subunit vaccine based on the insertion of 27 amino acids from Omp31 to the N-terminus of BLS induced a similar degree of protection agai...

    ID: 1462969

    Description: epitope description:NAGYAGGKFKHPFSSFDKEDNEQVSGS antigen name:31 kDa outer-membrane immunogenic protein host organism:Mus musculus BALB/c antibody name...

    Publication: 17442465;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston