Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Plasmodium falciparum: sera of individuals living in a malaria-endemic region recognize peptide motifs of the human erythrocyte anion transport protei...

    ID: 1381855

    Description: epitope description:TFGGLLGEKT antigen name:Band 3 anion transport protein host organism:Homo sapiens

    Publication: 7539597;

  2. Plasmodium falciparum: sera of individuals living in a malaria-endemic region recognize peptide motifs of the human erythrocyte anion transport protei...

    ID: 1381858

    Description: epitope description:LLGEKTRNQM antigen name:Band 3 anion transport protein host organism:Homo sapiens

    Publication: 7539597;

  3. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379440

    Description: epitope description:VLAVDAPN antigen name:Other Leishmania infantum protein host organism:Homo sapiens

    Publication: 9229379;

  4. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379442

    Description: epitope description:TAGRFDSP antigen name:Other Leishmania infantum protein host organism:Homo sapiens

    Publication: 9229379;

  5. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379444

    Description: epitope description:VWSILNRI antigen name:Other Leishmania infantum protein host organism:Homo sapiens

    Publication: 9229379;

  6. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379445

    Description: epitope description:LNRIVRTL antigen name:Other Leishmania infantum protein host organism:Homo sapiens

    Publication: 9229379;

  7. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379446

    Description: epitope description:VRTLLHGG antigen name:Leishmania aethiopica protein host organism:Homo sapiens

    Publication: 9229379;

  8. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379456

    Description: epitope description:HAFCHEEG antigen name:Leishmania aethiopica protein host organism:Homo sapiens

    Publication: 9229379;

  9. Monoclonal antibodies targeting the HR2 domain and the region immediately upstream of the HR2 of the S protein neutralize in vitro infection of severe...

    ID: 1379481

    Description: epitope description:ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYI antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:1G10

    Publication: 16378996;

  10. Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

    ID: 1379488

    Description: epitope description:GPPAA antigen name:Epstein-Barr nuclear antigen 6 host organism:Homo sapiens

    Publication: 7508347;

  11. Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

    ID: 1379498

    Description: epitope description:GRPVA antigen name:HLA class II histocompatibility antigen, DRB1-7 beta chain host organism:Homo sapiens

    Publication: 7508347;

  12. Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

    ID: 1379511

    Description: epitope description:GRLDA antigen name:HLA class II histocompatibility antigen, DQ beta 1 chain (UniProt:P01920) host organism:Homo sapiens

    Publication: 7508347;

  13. Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

    ID: 1379512

    Description: epitope description:GPPAAGPPAAGPPAA antigen name:Epstein-Barr nuclear antigen 6 host organism:Homo sapiens

    Publication: 7508347;

  14. Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

    ID: 1379517

    Description: epitope description:GPPAAEYWNSQ antigen name:HLA class II histocompatibility antigen, DQ beta 1 chain (UniProt:P01920) host organism:Oryctolagus cunic...

    Publication: 7508347;

  15. Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

    ID: 1379526

    Description: epitope description:TPLGPPAAEYW antigen name:HLA class II histocompatibility antigen, DQ beta 1 chain (UniProt:P01920) host organism:Homo sapiens

    Publication: 7508347;

  16. Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

    ID: 1379530

    Description: epitope description:GPPAAEYGPPAAEY host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7508347;

  17. Recognition of synthetic 104-mer and 102-mer peptides corresponding to N- and C-terminal nonrepeat regions of the Plasmodium falciparum circumsporozoi...

    ID: 1379535

    Description: epitope description:DNAGTNLYNELEMNYYGKQENWYSLKKNSRSLGENDDGNNN antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:Huma...

    Publication: 8916800;

  18. Recognition of synthetic 104-mer and 102-mer peptides corresponding to N- and C-terminal nonrepeat regions of the Plasmodium falciparum circumsporozoi...

    ID: 1379537

    Description: epitope description:KNNQGNGQGHNMPNDPNRNVDENANANN antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:Human sera

    Publication: 8916800;

  19. Recognition of synthetic 104-mer and 102-mer peptides corresponding to N- and C-terminal nonrepeat regions of the Plasmodium falciparum circumsporozoi...

    ID: 1379538

    Description: epitope description:NAVKNNNNEEPSDKHIEQYLKKIKNSISTEW antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:Human sera

    Publication: 8916800;

  20. Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

    ID: 1379539

    Description: epitope description:TPQGRPVAEYW antigen name:HLA class II histocompatibility antigen, DQ beta 1 chain (UniProt:P01920) host organism:Homo sapiens

    Publication: 7508347;

  21. Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

    ID: 1379553

    Description: epitope description:TPLGRLDAEYW antigen name:HLA class II histocompatibility antigen, DQ beta 1 chain (UniProt:P01920) host organism:Oryctolagus cunic...

    Publication: 7508347;

  22. Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

    ID: 1379554

    Description: epitope description:TPLGRLDAEYW antigen name:HLA class II histocompatibility antigen, DQ beta 1 chain (UniProt:P01920) host organism:Homo sapiens

    Publication: 7508347;

  23. Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

    ID: 1379559

    Description: epitope description:ESSSSDKP antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

    Publication: 9430535;

  24. Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

    ID: 1379563

    Description: epitope description:SSSDKPDN antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

    Publication: 9430535;

  25. Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

    ID: 1379565

    Description: epitope description:KPEASSTN antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

    Publication: 9430535;

  26. Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

    ID: 1379566

    Description: epitope description:SSTNKPEA antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

    Publication: 9430535;

  27. Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

    ID: 1379568

    Description: epitope description:NSNDKSGS antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

    Publication: 9430535;

  28. Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

    ID: 1379569

    Description: epitope description:KSGSSSDN antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

    Publication: 9430535;

  29. Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

    ID: 1379570

    Description: epitope description:NDKSGSSS antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

    Publication: 9430535;

  30. Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

    ID: 1379585

    Description: epitope description:YGVFLKNE antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

    Publication: 9430535;

  31. Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

    ID: 1379586

    Description: epitope description:VFLKNEAS antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

    Publication: 9430535;

  32. Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

    ID: 1379592

    Description: epitope description:EEAEEKEK antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

    Publication: 9430535;

  33. Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

    ID: 1379595

    Description: epitope description:EKSSSAKP antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

    Publication: 9430535;

  34. Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

    ID: 1379599

    Description: epitope description:SSNEDNED antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

    Publication: 9430535;

  35. Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

    ID: 1379602

    Description: epitope description:EDDEDEKA antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

    Publication: 9430535;

  36. Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

    ID: 1379605

    Description: epitope description:KASSSDNS antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

    Publication: 9430535;

  37. Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

    ID: 1379611

    Description: epitope description:SDKPEASS antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

    Publication: 9430535;

  38. Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

    ID: 1379614

    Description: epitope description:EASSTSNS antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

    Publication: 9430535;

  39. Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

    ID: 1379621

    Description: epitope description:NNLDAASS antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

    Publication: 9430535;

  40. Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

    ID: 1379625

    Description: epitope description:PFIVFCAI antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

    Publication: 9430535;

  41. Location of monoclonal antibody binding sites in the capsid protein of feline calicivirus.

    ID: 1379634

    Description: epitope description:DTTIPGELIPAGDYAITNGTGNDITTATGYDTADIIK antigen name:Capsid protein host organism:Mus musculus antibody name:4E7

    Publication: 1383410;

  42. Identification of the core residues of the epitope of a monoclonal antibody raised against glycoprotein D of herpes simplex virus type 1 by screening ...

    ID: 1379636

    Description: epitope description:FFHNGRFSDALRFTL host organism:Mus musculus BALB/c antibody name:A16

    Publication: 7805747;

  43. Identification of the core residues of the epitope of a monoclonal antibody raised against glycoprotein D of herpes simplex virus type 1 by screening ...

    ID: 1379638

    Description: epitope description:FFHNGRFSDALRFTL host organism:Mus musculus BALB/c antibody name:A16

    Publication: 7805747;

  44. Characterization of human monoclonal antibodies directed against the pp65-kD matrix antigen of human cytomegalovirus.

    ID: 1379663

    Description: epitope description:KPGKIS antigen name:65 kDa phosphoprotein host organism:Homo sapiens antibody name:MO58

    Publication: 1710548;

  45. Characterization of human monoclonal antibodies directed against the pp65-kD matrix antigen of human cytomegalovirus.

    ID: 1379664

    Description: epitope description:KPGKIS antigen name:65 kDa phosphoprotein host organism:Homo sapiens antibody name:MO58

    Publication: 1710548;

  46. Direct lysis of Trypanosoma cruzi: a novel effector mechanism of protection mediated by human anti-gal antibodies.

    ID: 1379666

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactosyl group antigen name:polysaccharide host organism:Homo sapiens

    Publication: 1717927;

  47. Characterization of human monoclonal antibodies directed against the pp65-kD matrix antigen of human cytomegalovirus.

    ID: 1379669

    Description: epitope description:M208, E209, N210, T211, R212, A213, T214, K215, M216, M280, I281, I282, K283, P284, G285 antigen name:65 kDa phosphoprotein host o...

    Publication: 1710548;

  48. Widespread reactivity of human sera with a variant repeat of the circumsporozoite protein of Plasmodium vivax.

    ID: 1379673

    Description: epitope description:ANGAGNQPGANGAGNQPGANGAGNQPGANGAGNQPG antigen name:Circumsporozoite protein, putative host organism:Mus musculus

    Publication: 2122747;

  49. Epitope changes on the haemagglutinin molecule of recently isolated H1N1 influenza viruses.

    ID: 1379679

    Description: epitope description:R125 antigen name:Hemagglutinin host organism:Mus musculus antibody name:mAb 110

    Publication: 1703564;

  50. Antibodies to hepatitis B surface antigen (HBsAg) elicited by immunization with a synthetic peptide covalently linked to liposomes.

    ID: 1379684

    Description: epitope description:PSCCCTKPSDGNCTCIPIPSS antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6202827;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston