Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. A large-scale evaluation of peptide vaccines against foot-and-mouth disease: lack of solid protection in cattle and isolation of escape mutants.

    ID: 1481449

    Description: epitope description:RHKQPLIAPAKQLLPPSAGARRGDLAHLAAAHARHLP host organism:Bos taurus Friesian

    Publication: 9060612;

  2. Failure to detect evidence of human T-lymphotropic virus (HTLV) type I and type II in blood donors with isolated gag antibodies to HTLV-I/II.

    ID: 1481646

    Description: epitope description:KKPNRQGLGYYSPSYNDP antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1627806;

  3. Enhanced specificity of truncated transmembrane protein for serologic confirmation of human T-cell lymphotropic virus type 1 (HTLV-1) and HTLV-2 infec...

    ID: 1481735

    Description: epitope description:IVKNHKNLLKIAQYAAQNRRGLDLLFWEQGGLCKALQEQCRFPN antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8586709;

  4. Mapping of three antigenic sites on the haemagglutinin-neuraminidase protein of Newcastle disease virus.

    ID: 1481748

    Description: epitope description:D287, T290, E293 antigen name:Hemagglutinin-neuraminidase host organism:Mus musculus antibody name:445

    Publication: 2464879;

  5. Mapping of three antigenic sites on the haemagglutinin-neuraminidase protein of Newcastle disease virus.

    ID: 1481751

    Description: epitope description:E347, D349 antigen name:Hemagglutinin-neuraminidase host organism:Mus musculus antibody name:NHN-8 and NHN-10

    Publication: 2464879;

  6. Mapping of three antigenic sites on the haemagglutinin-neuraminidase protein of Newcastle disease virus.

    ID: 1481755

    Description: epitope description:K284 antigen name:Hemagglutinin-neuraminidase host organism:Mus musculus antibody name:8C11

    Publication: 2464879;

  7. Mapping of three antigenic sites on the haemagglutinin-neuraminidase protein of Newcastle disease virus.

    ID: 1481757

    Description: epitope description:N481 antigen name:Hemagglutinin-neuraminidase host organism:Mus musculus antibody name:NHN-1

    Publication: 2464879;

  8. Mapping of three antigenic sites on the haemagglutinin-neuraminidase protein of Newcastle disease virus.

    ID: 1481763

    Description: epitope description:R460 antigen name:Hemagglutinin-neuraminidase host organism:Mus musculus antibody name:NHN-3

    Publication: 2464879;

  9. Mapping of three antigenic sites on the haemagglutinin-neuraminidase protein of Newcastle disease virus.

    ID: 1481765

    Description: epitope description:K284 antigen name:Hemagglutinin-neuraminidase host organism:Mus musculus antibody name:8C11

    Publication: 2464879;

  10. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481778

    Description: epitope description:CVCRSCRTMSLQKTVEKLFD antigen name:Immunogenic protein host organism:Homo sapiens

    Publication: 17403055;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston