Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582636

    Description: epitope description:VAGLQN host organism:Mus musculus C57BL/10

    Publication: 7518628;

  2. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582637

    Description: epitope description:AGLQND host organism:Mus musculus C57BL/10

    Publication: 7518628;

  3. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582644

    Description: epitope description:TTNVAR host organism:Mus musculus C57BL/10

    Publication: 7518628;

  4. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582646

    Description: epitope description:SATAIF antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  5. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582648

    Description: epitope description:TAIFDT antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  6. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582651

    Description: epitope description:FDTTTL antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  7. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582658

    Description: epitope description:PTIAGA antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  8. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582660

    Description: epitope description:IAGAGD antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  9. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582661

    Description: epitope description:AGAGDV antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  10. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582668

    Description: epitope description:ASAEGQ antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  11. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582670

    Description: epitope description:AEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  12. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582672

    Description: epitope description:CSATAIFDTTTLNPTIAGAGDVKASACAAPTTSDVAGLQNDPTTNVA host organism:Mus musculus C57BL/10

    Publication: 7518628;

  13. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582676

    Description: epitope description:CSATAIFDTTTLNPTIAGAGDVKASACAAPTTSDVAGLQNDPTTNVA host organism:Mus musculus C57BL/10

    Publication: 7518628;

  14. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582680

    Description: epitope description:CSATAIFDTTTLNPTIAGAGDVKASACAAPTTSDVAGLQNDPTTNVA host organism:Mus musculus C57BL/10

    Publication: 7518628;

  15. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582683

    Description: epitope description:CSATAIFDTTTLNPTIAGAGDVKASACAAPTTSDVAGLQNDPTTNVA host organism:Mus musculus C57BL/10

    Publication: 7518628;

  16. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582696

    Description: epitope description:CSATAIFDTTTLNPTIAGAGDVKASACAAPTTSDVAGLQNDPTTNVA host organism:Mus musculus C57BL/10

    Publication: 7518628;

  17. Epitope mapping of antibodies recognising the N-terminal domain of simian virus large tumour antigen.

    ID: 1582770

    Description: epitope description:TEIPTYGTDEWEQWW antigen name:Macaca mulatta polyomavirus 1 protein host organism:Mus musculus BALB/c antibody name:pAb 211, pAb 22...

    Publication: 9705560;

  18. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583400

    Description: epitope description:SDSNLKDLTF antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:Sheep serum

    Publication: 8828217;

  19. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583422

    Description: epitope description:EKVTIQNWFR antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  20. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583425

    Description: epitope description:TIQNWFREAD antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston