Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Widespread reactivity of human sera with a variant repeat of the circumsporozoite protein of Plasmodium vivax.

    ID: 1379689

    Description: epitope description:NAAGNAAGNAAGNAAG antigen name:Circumsporozoite protein host organism:Mus musculus A/J

    Publication: 2122747;

  2. Widespread reactivity of human sera with a variant repeat of the circumsporozoite protein of Plasmodium vivax.

    ID: 1379690

    Description: epitope description:NAAGNAAGNAAGNAAG antigen name:Circumsporozoite protein host organism:Mus musculus

    Publication: 2122747;

  3. A novel recombinant multiepitope protein as a hepatitis C diagnostic intermediate of high sensitivity and specificity.

    ID: 1379700

    Description: epitope description:MSTLPKPQRQTKRNTPRRPQNVKFPGGGQIVGGVYVLPRRGPRL antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 16504539;

  4. Monoclonal antibodies to hepatitis B surface antigen (HBsAg) with anti-alpha specificity recognize a synthetic peptide analogue (S135-155) with unmodi...

    ID: 1379750

    Description: epitope description:PSCCCTKPSDGNCTCIPIPSS antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:anti-a group mAb 5D3

    Publication: 6442302;

  5. Isotype-specific immune response to a single hepatitis C virus core epitope defined by a human monoclonal antibody: diagnostic value and correlation t...

    ID: 1379756

    Description: epitope description:VYLLPR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8086507;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston