Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Synergistic effect of immunization with a peptide cocktail inducing antibody, helper and cytotoxic T-cell responses on protection against respiratory ...

    ID: 1481784

    Description: epitope description:HWSISKPQ host organism:Mus musculus BALB/c

    Publication: 10374957;

  2. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481807

    Description: epitope description:SISSLSNKIVNYESKIEELEKELKEVK antigen name:Uncharacterized protein PFB0145c host organism:Homo sapiens antibody name:Human sera

    Publication: 17653272;

  3. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481809

    Description: epitope description:DNNVNNMDNNVNNVDNNVNNVDNNLNNVDNNVNN antigen name:AP2/ERF domain-containing protein PFD0985w host organism:Homo sapiens antibody nam...

    Publication: 17653272;

  4. Immunogenicity of variable regions of the surface envelope glycoprotein of HTLV type I and identification of new major epitopes in the 239-261 region.

    ID: 1481815

    Description: epitope description:PHWTKKPNRNGGGYYSASYSDP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8798979;

  5. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481818

    Description: epitope description:IKTMNTQISTLKNDVHLLNEQIDKLNNEKGTLNSKISELNVQIMDL antigen name:Uncharacterized protein PFB0145c host organism:Mus musculus antibody n...

    Publication: 17653272;

  6. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481823

    Description: epitope description:KKRNVEEELHSLRKNYNIINEEIEEIT antigen name:RING finger protein PFF0165c host organism:Mus musculus antibody name:Mouse sera

    Publication: 17653272;

  7. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481825

    Description: epitope description:KIQIEEIKKETNQINKDIDHIEMNIINLKKKIEF antigen name:Serine--tRNA ligase, cytoplasmic host organism:Mus musculus antibody name:Mouse se...

    Publication: 17653272;

  8. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481836

    Description: epitope description:CVCRSCRTMSLQKTVEKLFDELDKDKSGKISCAELKSALQSCSAEPLDDDH antigen name:Immunogenic protein host organism:Mus musculus Outbred

    Publication: 17403055;

  9. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481837

    Description: epitope description:ELKSALQSCSAEPLDDDHVKAFLDKLDSNKDGELSLDELMALF antigen name:Immunogenic protein host organism:Mus musculus Outbred

    Publication: 17403055;

  10. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481838

    Description: epitope description:ELDKDKSGKISCAELKSALQ antigen name:Immunogenic protein host organism:Mus musculus Outbred

    Publication: 17403055;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston