Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481845

    Description: epitope description:AELKSALQSCSAEPLDDDHVKAFLDK antigen name:Immunogenic protein host organism:Homo sapiens

    Publication: 17403055;

  2. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481846

    Description: epitope description:HVKAFLDKLDSNKDGELSLDELMALF antigen name:Immunogenic protein host organism:Homo sapiens

    Publication: 17403055;

  3. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481860

    Description: epitope description:ELKSALQSCSAEPLDDDHVKAFLDKLDSNKDGELSLDELMALF antigen name:Immunogenic protein host organism:Homo sapiens

    Publication: 17403055;

  4. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481866

    Description: epitope description:CVCRSCRTMSLQKTVEKLFDELDKDKSGKISCAELKSALQ antigen name:Immunogenic protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17403055;

  5. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481875

    Description: epitope description:DKLDSNKDGELSLDELMALF antigen name:Immunogenic protein host organism:Mus musculus BALB/c

    Publication: 17403055;

  6. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481876

    Description: epitope description:ELDKDKSGKISCAELKSALQSCSAEPLDDDH antigen name:Immunogenic protein host organism:Mus musculus BALB/c

    Publication: 17403055;

  7. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481879

    Description: epitope description:ELKSALQSCSAEPLDDDHVKAFLDKLDSNKDGELSLDELMALF antigen name:Immunogenic protein host organism:Mus musculus BALB/c

    Publication: 17403055;

  8. An epitope located at the C terminus of isolated VP1 of foot-and-mouth disease virus type O induces neutralizing activity but poor protection.

    ID: 1481882

    Description: epitope description:GDLQVLA antigen name:Polyprotein host organism:Oryctolagus cuniculus antibody name:anti-146-152

    Publication: 2418152;

  9. An epitope located at the C terminus of isolated VP1 of foot-and-mouth disease virus type O induces neutralizing activity but poor protection.

    ID: 1481908

    Description: epitope description:RHKQKIVAPVK antigen name:Polyprotein host organism:Mus musculus BALB/c antibody name:MCA a-A

    Publication: 2418152;

  10. Immunogenicity of variable regions of the surface envelope glycoprotein of HTLV type I and identification of new major epitopes in the 239-261 region.

    ID: 1481930

    Description: epitope description:VLYSPNVSVPSSSSTPLLYPSLA antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8798979;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston