Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Successful adjuvant-free vaccination of BALB/c mice with mutated amyloid beta peptides.

    ID: 1643132

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAMDVGSNKGAIIGLMVGGVVIA host organism:Mus musculus BALB/c

    Publication: 18282292;

  2. Successful adjuvant-free vaccination of BALB/c mice with mutated amyloid beta peptides.

    ID: 1643133

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAMDVGSNKGAIIGLMVGGVVIA host organism:Mus musculus BALB/c

    Publication: 18282292;

  3. Successful adjuvant-free vaccination of BALB/c mice with mutated amyloid beta peptides.

    ID: 1643134

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAMDVGSNKGAIIGLMVGGVVIA host organism:Mus musculus BALB/c

    Publication: 18282292;

  4. Successful adjuvant-free vaccination of BALB/c mice with mutated amyloid beta peptides.

    ID: 1643135

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAMDVGSNKGAIIGLMVGGVVIA host organism:Mus musculus BALB/c

    Publication: 18282292;

  5. Successful adjuvant-free vaccination of BALB/c mice with mutated amyloid beta peptides.

    ID: 1643149

    Description: epitope description:DAEFRHDSGYEVHHQK antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c

    Publication: 18282292;

  6. Successful adjuvant-free vaccination of BALB/c mice with mutated amyloid beta peptides.

    ID: 1643156

    Description: epitope description:VHHQKLVFFAEDVGSNK antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c

    Publication: 18282292;

  7. Successful adjuvant-free vaccination of BALB/c mice with mutated amyloid beta peptides.

    ID: 1643165

    Description: epitope description:GAIIGLMVGGVVIA antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c

    Publication: 18282292;

  8. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643202

    Description: epitope description:SKGCCSGAKRLD antigen name:Other Parietaria judaica protein host organism:Homo sapiens

    Publication: 12680870;

  9. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643213

    Description: epitope description:KLPPIDVNMDCK antigen name:Other Parietaria judaica protein host organism:Homo sapiens

    Publication: 12680870;

  10. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643214

    Description: epitope description:DVNMDCKTVGVV antigen name:Par j 1 host organism:Homo sapiens

    Publication: 12680870;

  11. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643223

    Description: epitope description:CLPFVQGKEK antigen name:Other Parietaria judaica protein host organism:Homo sapiens

    Publication: 12680870;

  12. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643224

    Description: epitope description:PFVQGKEKEP antigen name:Other Parietaria judaica protein host organism:Homo sapiens

    Publication: 12680870;

  13. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643227

    Description: epitope description:EKEPSKGCCS antigen name:Other Parietaria judaica protein host organism:Homo sapiens

    Publication: 12680870;

  14. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643230

    Description: epitope description:GCCSGAKRLD antigen name:Other Parietaria judaica protein host organism:Homo sapiens

    Publication: 12680870;

  15. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643238

    Description: epitope description:PQRVHACECI antigen name:Par j 1 host organism:Homo sapiens

    Publication: 12680870;

  16. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643241

    Description: epitope description:EVPKHCGIVD antigen name:Other Parietaria judaica protein host organism:Homo sapiens

    Publication: 12680870;

  17. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643253

    Description: epitope description:LERPQIRVPP antigen name:Other Parietaria judaica protein host organism:Homo sapiens

    Publication: 12680870;

  18. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643267

    Description: epitope description:KLSEEVKTTEQK antigen name:Par j 2 host organism:Homo sapiens

    Publication: 12680870;

  19. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643268

    Description: epitope description:VKTTEQKREACK antigen name:Par j 2 host organism:Homo sapiens

    Publication: 12680870;

  20. Antigenic characterization and cytolocalization of P35, the major Mycoplasma penetrans antigen.

    ID: 1627842

    Description: epitope description:KATPNDGYFWED antigen name:Lipoprotein p35 host organism:Macaca

    Publication: 10075417;

  21. Antigenic characterization and cytolocalization of P35, the major Mycoplasma penetrans antigen.

    ID: 1627843

    Description: epitope description:NDGYFWEDGTNG antigen name:Lipoprotein p35 host organism:Macaca

    Publication: 10075417;

  22. Immunological characterization of antibodies against synthetic peptides of glutamic acid decarboxylase.

    ID: 1630720

    Description: epitope description:SFGSEDGSGDSENPGTARAWC antigen name:Glutamate decarboxylase 2 host organism:Oryctolagus cuniculus

    Publication: 8814352;

  23. Structures of two major allergens, Bla g 4 and Per a 4, from cockroaches and their IgE binding epitopes.

    ID: 1630721

    Description: epitope description:R29, R31, K80, K85 antigen name:Bla g 4 host organism:Homo sapiens

    Publication: 19056737;

  24. Immunological characterization of antibodies against synthetic peptides of glutamic acid decarboxylase.

    ID: 1630722

    Description: epitope description:ATSSNAGADPNTTNLRPTTYDTWC antigen name:Glutamate decarboxylase 1 host organism:Oryctolagus cuniculus

    Publication: 8814352;

  25. Structures of two major allergens, Bla g 4 and Per a 4, from cockroaches and their IgE binding epitopes.

    ID: 1630724

    Description: epitope description:D16, D49, E80, Q105 antigen name:Other Periplaneta americana (American cockroach) protein host organism:Homo sapiens

    Publication: 19056737;

  26. Immunological characterization of antibodies against synthetic peptides of glutamic acid decarboxylase.

    ID: 1630725

    Description: epitope description:FFRMVISNPAATQSDIDFLIE antigen name:Glutamate decarboxylase 1 host organism:Oryctolagus cuniculus

    Publication: 8814352;

  27. Immunological characterization of antibodies against synthetic peptides of glutamic acid decarboxylase.

    ID: 1630737

    Description: epitope description:ATSSNAGADPNTTNLRPTTYDTWC antigen name:Glutamate decarboxylase 1 host organism:Oryctolagus cuniculus

    Publication: 8814352;

  28. Immunological characterization of antibodies against synthetic peptides of glutamic acid decarboxylase.

    ID: 1630772

    Description: epitope description:SFGSEDGSGDSENPGTARAWC antigen name:Glutamate decarboxylase 2 host organism:Oryctolagus cuniculus

    Publication: 8814352;

  29. Novel affinity tag system using structurally defined antibody-tag interaction: application to single-step protein purification.

    ID: 1630832

    Description: epitope description:PRGYPGQV antigen name:Proteinase-activated receptor 4 host organism:Mus musculus BALB/c antibody name:P20.1

    Publication: 18787202;

  30. Antigenic characterization and cytolocalization of P35, the major Mycoplasma penetrans antigen.

    ID: 1630850

    Description: epitope description:DTKTGTDRETTS antigen name:Lipoprotein p35 host organism:Homo sapiens

    Publication: 10075417;

  31. Antigenic characterization and cytolocalization of P35, the major Mycoplasma penetrans antigen.

    ID: 1630858

    Description: epitope description:CDLIPNLKLNNG antigen name:Lipoprotein p35 host organism:Homo sapiens

    Publication: 10075417;

  32. Antigenic characterization and cytolocalization of P35, the major Mycoplasma penetrans antigen.

    ID: 1630859

    Description: epitope description:PNLKLNNGTDYK antigen name:Lipoprotein p35 host organism:Homo sapiens

    Publication: 10075417;

  33. Antigenic characterization and cytolocalization of P35, the major Mycoplasma penetrans antigen.

    ID: 1630863

    Description: epitope description:TLAEADRTNAEK antigen name:Lipoprotein p35 host organism:Homo sapiens

    Publication: 10075417;

  34. Antigenic characterization and cytolocalization of P35, the major Mycoplasma penetrans antigen.

    ID: 1630870

    Description: epitope description:NDGYFWEDGTNG antigen name:Lipoprotein p35 host organism:Homo sapiens

    Publication: 10075417;

  35. Monoclonal antibody 76F distinguishes IA-2 from IA-2beta and overlaps an autoantibody epitope.

    ID: 1630872

    Description: epitope description:FEYQD antigen name:Receptor-type tyrosine-protein phosphatase-like N host organism:Mus musculus BALB/c antibody name:76F

    Publication: 16503116;

  36. Humoral immune responses of dengue fever patients using epitope-specific serotype-2 virus-like particle antigens.

    ID: 1630906

    Description: epitope description:G106 antigen name:Genome polyprotein host organism:Mus musculus antibody name:4A1B-9

    Publication: 19337372;

  37. Humoral immune responses of dengue fever patients using epitope-specific serotype-2 virus-like particle antigens.

    ID: 1630913

    Description: epitope description:G106, L107, P364 antigen name:Genome polyprotein host organism:Mus musculus antibody name:1B4C-2

    Publication: 19337372;

  38. Characterization of the serological response to phospholipase D protein of Chlamydophila pneumoniae in patients with acute coronary syndromes.

    ID: 1630941

    Description: epitope description:TIYYQKFKIPQILK antigen name:UniProt:Q7VQ43 host organism:Mus musculus ICR

    Publication: 19397877;

  39. Characterization of the serological response to phospholipase D protein of Chlamydophila pneumoniae in patients with acute coronary syndromes.

    ID: 1630952

    Description: epitope description:TIYYQKFKIPQILK antigen name:UniProt:Q7VQ43 host organism:Homo sapiens

    Publication: 19397877;

  40. Monoclonal antibody 76F distinguishes IA-2 from IA-2beta and overlaps an autoantibody epitope.

    ID: 1630961

    Description: epitope description:WQALCAYQAE antigen name:Receptor-type tyrosine-protein phosphatase-like N host organism:Mus musculus BALB/c antibody name:A9

    Publication: 16503116;

  41. Monoclonal antibody 76F distinguishes IA-2 from IA-2beta and overlaps an autoantibody epitope.

    ID: 1630962

    Description: epitope description:WQALCAYQAE antigen name:Receptor-type tyrosine-protein phosphatase-like N host organism:Mus musculus BALB/c antibody name:A9

    Publication: 16503116;

  42. Peptide specificity of high-titer anti-glutamic acid decarboxylase (GAD)65 autoantibodies.

    ID: 1631038

    Description: epitope description:GFWSFGSEDGSG antigen name:Glutamate decarboxylase 2 host organism:Homo sapiens

    Publication: 9698109;

  43. Peptide specificity of high-titer anti-glutamic acid decarboxylase (GAD)65 autoantibodies.

    ID: 1631044

    Description: epitope description:KLCALLYGDAEK antigen name:Glutamate decarboxylase 2 host organism:Homo sapiens

    Publication: 9698109;

  44. Peptide specificity of high-titer anti-glutamic acid decarboxylase (GAD)65 autoantibodies.

    ID: 1631052

    Description: epitope description:PCSCSKVDVNYA antigen name:Glutamate decarboxylase 2 host organism:Homo sapiens

    Publication: 9698109;

  45. Peptide specificity of high-titer anti-glutamic acid decarboxylase (GAD)65 autoantibodies.

    ID: 1631054

    Description: epitope description:AFDPLLAVADIC antigen name:Glutamate decarboxylase 2 host organism:Homo sapiens

    Publication: 9698109;

  46. Genetic differentiation of poly I:C from B:9-23 peptide induced experimental autoimmune diabetes.

    ID: 1631102

    Description: epitope description:SHLVEALYLVCGERG antigen name:Insulin-2 (UniProt:P01326) host organism:Mus musculus C57BL/6 antibody name:Insulin autoantibodies (I...

    Publication: 15120754;

  47. Peptide mimics selected from immune sera using phage display technology can replace native antigens in the diagnosis of Epstein-Barr virus infection.

    ID: 1631152

    Description: epitope description:FVNAFQNANFMRPRELFALA host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19073711;

  48. Peptide mimics selected from immune sera using phage display technology can replace native antigens in the diagnosis of Epstein-Barr virus infection.

    ID: 1631154

    Description: epitope description:SANLNFFSPDFGLYTPNASA host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19073711;

  49. Peptide mimics selected from immune sera using phage display technology can replace native antigens in the diagnosis of Epstein-Barr virus infection.

    ID: 1631157

    Description: epitope description:RLRGDYNVGPIRFGWPVAPN host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19073711;

  50. Peptide mimics selected from immune sera using phage display technology can replace native antigens in the diagnosis of Epstein-Barr virus infection.

    ID: 1631162

    Description: epitope description:GVTDFDFKVFSSTFPKIFLS host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19073711;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston