Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475236

    Description: epitope description:AAESQIRDVDFAAESANYSKANILAQSGSY antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  2. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475238

    Description: epitope description:AAESQIRDVDFAAESANYSKANILAQSGSY antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  3. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475240

    Description: epitope description:AAESQIRDVDFAAESANYSKANILAQSGSY antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  4. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475251

    Description: epitope description:YSKANILAQSGSYAMAQANSVQQNVLRLLQ antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  5. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475254

    Description: epitope description:YSKANILAQSGSYAMAQANSVQQNVLRLLQ antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  6. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475255

    Description: epitope description:YSKANILAQSGSYAMAQANSVQQNVLRLLQ antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  7. Cellular and molecular characterization of a major soybean allergen.

    ID: 1475276

    Description: epitope description:SQQIKMANKKMKKEQ antigen name:P34 probable thiol protease host organism:Homo sapiens antibody name:pooled patient sera

    Publication: 9751845;

  8. Cellular and molecular characterization of a major soybean allergen.

    ID: 1475281

    Description: epitope description:GVITQVKYQGGCGRG antigen name:P34 probable thiol protease host organism:Homo sapiens antibody name:pooled patient sera

    Publication: 9751845;

  9. Cellular and molecular characterization of a major soybean allergen.

    ID: 1475285

    Description: epitope description:EPAHAIATGDLVSLS antigen name:Other Glycine max (soybeans) protein host organism:Homo sapiens antibody name:pooled patient sera

    Publication: 9751845;

  10. Cellular and molecular characterization of a major soybean allergen.

    ID: 1475297

    Description: epitope description:IDGYETVIMSDESTE antigen name:Other Glycine max (soybeans) protein host organism:Homo sapiens antibody name:pooled patient sera

    Publication: 9751845;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston