Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. SARS corona virus peptides recognized by antibodies in the sera of convalescent cases.

    ID: 8440

    Description: epitope description:GAGICASY antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15207612;

  2. SARS corona virus peptides recognized by antibodies in the sera of convalescent cases.

    ID: 8447

    Description: epitope description:AMQMAYRF antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15207612;

  3. SARS corona virus peptides recognized by antibodies in the sera of convalescent cases.

    ID: 8454

    Description: epitope description:LEDPCKV antigen name:Protein non-structural 8a host organism:Homo sapiens

    Publication: 15207612;

  4. Structural basis for helper T-cell and antibody epitope immunodominance in bacteriophage T4 Hsp10. Role of disordered loops.

    ID: 8488

    Description: epitope description:HPFVALGLKQPKEIK antigen name:Capsid assembly protein Gp31 host organism:Mus musculus

    Publication: 11602571;

  5. Conformational epitope mapping of OmpC, a major cell surface antigen from Salmonella typhi.

    ID: 8561

    Description: epitope description:D46, Y231, K173 antigen name:Outer membrane protein C host organism:Mus musculus BALB/c antibody name:P7D8

    Publication: 15363785;

  6. Identification of immunodominant epitope of F1 antigen of Yersinia pestis.

    ID: 8686

    Description: epitope description:FTTKVIGKDSRDFDISPKV antigen name:F1 capsule antigen host organism:Mus musculus

    Publication: 10640611;

  7. Identification of immunodominant epitope of F1 antigen of Yersinia pestis.

    ID: 8687

    Description: epitope description:FFVRSIGSKGGKLAAGKYTDAVTV antigen name:F1 capsule antigen host organism:Mus musculus

    Publication: 10640611;

  8. Identification of immunodominant epitope of F1 antigen of Yersinia pestis.

    ID: 8689

    Description: epitope description:FFVRSIGSKGGKLAAGKYTDAVTV antigen name:F1 capsule antigen host organism:Mus musculus

    Publication: 10640611;

  9. Identification of immunodominant epitope of F1 antigen of Yersinia pestis.

    ID: 8691

    Description: epitope description:TSQDGNNHQFT antigen name:F1 capsule antigen host organism:Mus musculus

    Publication: 10640611;

  10. Identification of immunodominant epitope of F1 antigen of Yersinia pestis.

    ID: 8692

    Description: epitope description:TSQDGNNHQFT antigen name:F1 capsule antigen host organism:Mus musculus

    Publication: 10640611;

  11. Identification of immunodominant epitope of F1 antigen of Yersinia pestis.

    ID: 8695

    Description: epitope description:VNGENLVGDDVVLAT antigen name:F1 capsule antigen host organism:Mus musculus

    Publication: 10640611;

  12. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1575

    Description: epitope description:EVAKNLNESLIDLQELG antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  13. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1584

    Description: epitope description:PWYVWLGFIAGLIAIVM antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  14. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1590

    Description: epitope description:MVTILLCCMTSCCSCLK antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  15. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1594

    Description: epitope description:CMTSCCSCLKGACSCGS antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15356154;

  16. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1595

    Description: epitope description:LKGACSCGSCCKFDEDD antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15356154;

  17. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1600

    Description: epitope description:DDSEPVLKGVKLHYT antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15356154;

  18. Generation and characterization of anti-leptin antisera against synthetic peptides and recombinant protein.

    ID: 1602

    Description: epitope description:AASKSCPLPQVRALESLESL antigen name:Leptin host organism:Oryctolagus cuniculus Japanese white antibody name:anti-peptide 91-110

    Publication: 15647625;

  19. Computational peptide dissection of Melan-a/MART-1 oncoprotein antigenicity.

    ID: 1625

    Description: epitope description:PAYEKL antigen name:Melanoma antigen recognized by T-cells 1 host organism:Mus musculus antibody name:mAb-1

    Publication: 15501517;

  20. Plasmodium falciparum merozoite surface protein 6 displays multiple targets for naturally occurring antibodies that mediate monocyte-dependent parasit...

    ID: 1660

    Description: epitope description:EEEKKEEKKEEKKPDNEITNEVKEEQKYSSPSDINAQNLISN antigen name:Merozoite surface protein 6 host organism:Homo sapiens

    Publication: 15664972;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston