Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. A simple screening method for detecting bindings between oligopeptides and HLA-DR molecules on filter papers: possible application for mapping of puta...

    ID: 1627727

    Description: epitope description:FCSSSNFLG antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 10832968;

  2. A simple screening method for detecting bindings between oligopeptides and HLA-DR molecules on filter papers: possible application for mapping of puta...

    ID: 1627730

    Description: epitope description:SSNFLGISF antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 10832968;

  3. A simple screening method for detecting bindings between oligopeptides and HLA-DR molecules on filter papers: possible application for mapping of puta...

    ID: 1627731

    Description: epitope description:SNFLGISFL antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 10832968;

  4. A simple screening method for detecting bindings between oligopeptides and HLA-DR molecules on filter papers: possible application for mapping of puta...

    ID: 1627738

    Description: epitope description:FLLILMLIL antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 10832968;

  5. A simple screening method for detecting bindings between oligopeptides and HLA-DR molecules on filter papers: possible application for mapping of puta...

    ID: 1627742

    Description: epitope description:LMLILYSFI antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 10832968;

  6. A simple screening method for detecting bindings between oligopeptides and HLA-DR molecules on filter papers: possible application for mapping of puta...

    ID: 1627755

    Description: epitope description:DATCTEEDS antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 10832968;

  7. A simple screening method for detecting bindings between oligopeptides and HLA-DR molecules on filter papers: possible application for mapping of puta...

    ID: 1627762

    Description: epitope description:NNGGCDADA antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 10832968;

  8. A simple screening method for detecting bindings between oligopeptides and HLA-DR molecules on filter papers: possible application for mapping of puta...

    ID: 1627763

    Description: epitope description:ENNGGCDAD antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 10832968;

  9. A simple screening method for detecting bindings between oligopeptides and HLA-DR molecules on filter papers: possible application for mapping of puta...

    ID: 1627775

    Description: epitope description:DKCVENPNP antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 10832968;

  10. A simple screening method for detecting bindings between oligopeptides and HLA-DR molecules on filter papers: possible application for mapping of puta...

    ID: 1627779

    Description: epitope description:KQEGDKCVE antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 10832968;

  11. A simple screening method for detecting bindings between oligopeptides and HLA-DR molecules on filter papers: possible application for mapping of puta...

    ID: 1627780

    Description: epitope description:YKQEGDKCV antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 10832968;

  12. A simple screening method for detecting bindings between oligopeptides and HLA-DR molecules on filter papers: possible application for mapping of puta...

    ID: 1627781

    Description: epitope description:NYKQEGDKC antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 10832968;

  13. A simple screening method for detecting bindings between oligopeptides and HLA-DR molecules on filter papers: possible application for mapping of puta...

    ID: 1627791

    Description: epitope description:DEREECKCL antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 10832968;

  14. A simple screening method for detecting bindings between oligopeptides and HLA-DR molecules on filter papers: possible application for mapping of puta...

    ID: 1627795

    Description: epitope description:FRHLDEREE antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 10832968;

  15. A simple screening method for detecting bindings between oligopeptides and HLA-DR molecules on filter papers: possible application for mapping of puta...

    ID: 1627797

    Description: epitope description:GCFRHLDER antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 10832968;

  16. A simple screening method for detecting bindings between oligopeptides and HLA-DR molecules on filter papers: possible application for mapping of puta...

    ID: 1627800

    Description: epitope description:ENSGCFRHL antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 10832968;

  17. A simple screening method for detecting bindings between oligopeptides and HLA-DR molecules on filter papers: possible application for mapping of puta...

    ID: 1627804

    Description: epitope description:KKQCPENSG antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 10832968;

  18. Epitope characterization and variable region sequence of f1-40, a high-affinity monoclonal antibody to botulinum neurotoxin type a (Hall strain).

    ID: 1627816

    Description: epitope description:QPD antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody name:F1-40

    Publication: 19290051;

  19. Antigenic characterization and cytolocalization of P35, the major Mycoplasma penetrans antigen.

    ID: 1627819

    Description: epitope description:SENNGNGNGNGG antigen name:Lipoprotein p35 host organism:Macaca

    Publication: 10075417;

  20. Antigenic characterization and cytolocalization of P35, the major Mycoplasma penetrans antigen.

    ID: 1627823

    Description: epitope description:DTKTGTDRETTS antigen name:Lipoprotein p35 host organism:Macaca

    Publication: 10075417;

  21. Antigenic characterization and cytolocalization of P35, the major Mycoplasma penetrans antigen.

    ID: 1627825

    Description: epitope description:ETTSQMIVKDIK antigen name:Other Mycoplasma penetrans protein host organism:Macaca

    Publication: 10075417;

  22. Antigenic characterization and cytolocalization of P35, the major Mycoplasma penetrans antigen.

    ID: 1627829

    Description: epitope description:FTGEAYSYWSAK antigen name:Other Mycoplasma penetrans protein host organism:Macaca

    Publication: 10075417;

  23. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634502

    Description: epitope description:LAKELAWAPDEIREE antigen name:Malate synthase G host organism:Homo sapiens

    Publication: 19065269;

  24. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634508

    Description: epitope description:AGVNELVRVYVAQKR antigen name:DNA-directed RNA polymerase subunit beta (UniProt:P9WGY9) host organism:Homo sapiens

    Publication: 19065269;

  25. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634519

    Description: epitope description:RHGLSSLGWNLCRIF antigen name:PGL/p-HBAD biosynthesis rhamnosyltransferase host organism:Homo sapiens

    Publication: 19065269;

  26. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634520

    Description: epitope description:AIANAYWSPQARRRF antigen name:PGL/p-HBAD biosynthesis glycosyltransferase Rv2958c host organism:Homo sapiens

    Publication: 19065269;

  27. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634525

    Description: epitope description:FRMELLSLPQDEWAG antigen name:Polyketide synthase (UniProt:I6Y231) host organism:Homo sapiens

    Publication: 19065269;

  28. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634528

    Description: epitope description:LRPASCRFVPTCSQY antigen name:Putative membrane protein insertion efficiency factor host organism:Homo sapiens

    Publication: 19065269;

  29. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634534

    Description: epitope description:HWLRPITPTFRPSWP antigen name:Cyclopropane-fatty-acyl-phospholipid synthase (UniProt:Q7D9T1) host organism:Homo sapiens

    Publication: 19065269;

  30. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634542

    Description: epitope description:TVFKLTADGVLTAPQ antigen name:Polyketide synthase (UniProt:I6Y231) host organism:Homo sapiens

    Publication: 19065269;

  31. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634544

    Description: epitope description:VHPLLGSHVRLTEEP antigen name:Polyketide synthase (UniProt:I6Y231) host organism:Homo sapiens

    Publication: 19065269;

  32. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634554

    Description: epitope description:GGTHPTTTYKAFDWD antigen name:Immunogenic protein MPT64 host organism:Homo sapiens

    Publication: 19065269;

  33. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634555

    Description: epitope description:TTYKAFDWDQAYRKP antigen name:Immunogenic protein MPT64 host organism:Homo sapiens

    Publication: 19065269;

  34. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634556

    Description: epitope description:IMYNYPAMMAHAGDM antigen name:ESAT-6-like protein EsxR host organism:Homo sapiens

    Publication: 19065269;

  35. A highly divergent antigenic site of foot-and-mouth disease virus retains its immunodominance.

    ID: 1634700

    Description: epitope description:YTASARGDLARLTTTHARHLP host organism:Oryctolagus cuniculus New Zealand White

    Publication: 8546800;

  36. Effect of different anti-Abeta antibodies on Abeta fibrillogenesis as assessed by atomic force microscopy.

    ID: 1634703

    Description: epitope description:HHQKLVFFAEDVGSNK antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:m266.2

    Publication: 14698294;

  37. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1634719

    Description: epitope description:VDELD antigen name:Basic phospholipase A2 pseudexin B chain host organism:Mus musculus BALB/c antibody name:mAb 2

    Publication: 1718309;

  38. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1634721

    Description: epitope description:VDDLD antigen name:Acidic phospholipase A2 natratoxin host organism:Mus musculus BALB/c antibody name:mAb 2

    Publication: 1718309;

  39. Human antibodies reactive with beta-amyloid protein in Alzheimer's disease.

    ID: 1634728

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAEDVGSNK antigen name:Amyloid beta A4 protein host organism:Homo sapiens antibody name:MRE148, MRE267, MRE293,...

    Publication: 8459212;

  40. Analysis of GAD65 autoantibodies in Stiff-Person syndrome patients.

    ID: 1634759

    Description: epitope description:PGSGFWSFGSEDGSGDSEN antigen name:Glutamate decarboxylase 2 host organism:Mus musculus BALB/c antibody name:N-GAD65

    Publication: 16301686;

  41. Analysis of GAD65 autoantibodies in Stiff-Person syndrome patients.

    ID: 1634769

    Description: epitope description:PGSGFWSFGSEDGSGDSEN antigen name:Glutamate decarboxylase 2 host organism:Mus musculus BALB/c antibody name:hN-GAD65

    Publication: 16301686;

  42. Prototype Alzheimer's disease vaccine using the immunodominant B cell epitope from beta-amyloid and promiscuous T cell epitope pan HLA DR-binding pept...

    ID: 1634809

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c

    Publication: 15661919;

  43. Peripheral anti-A beta antibody alters CNS and plasma A beta clearance and decreases brain A beta burden in a mouse model of Alzheimer's disease.

    ID: 1634867

    Description: epitope description:HHQKLVFFAEDVGSNK antigen name:Amyloid beta A4 protein host organism:Mus musculus

    Publication: 11438712;

  44. Mapping the antigenic structure of porcine parvovirus at the level of peptides.

    ID: 1634938

    Description: epitope description:GLTLPGYKYLGPGNSLD antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9620208;

  45. Mapping the antigenic structure of porcine parvovirus at the level of peptides.

    ID: 1634939

    Description: epitope description:GYKYLGPGNSLDQGEPT antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9620208;

  46. Mapping the antigenic structure of porcine parvovirus at the level of peptides.

    ID: 1634941

    Description: epitope description:GYKYLGPGNSLDQGEPT antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9620208;

  47. Mapping the antigenic structure of porcine parvovirus at the level of peptides.

    ID: 1634948

    Description: epitope description:MSENVEQHNPINAGT antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9620208;

  48. Mapping the antigenic structure of porcine parvovirus at the level of peptides.

    ID: 1634951

    Description: epitope description:VEQHNPINAGTELSAT antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9620208;

  49. Mapping the antigenic structure of porcine parvovirus at the level of peptides.

    ID: 1634957

    Description: epitope description:QHNPINAGTELSATG antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9620208;

  50. Mapping the antigenic structure of porcine parvovirus at the level of peptides.

    ID: 1634965

    Description: epitope description:PINAGTELSATGNESG antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9620208;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston