Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Widespread reactivity of human sera with a variant repeat of the circumsporozoite protein of Plasmodium vivax.

    ID: 1379689

    Description: epitope description:NAAGNAAGNAAGNAAG antigen name:Circumsporozoite protein host organism:Mus musculus A/J

    Publication: 2122747;

  2. Widespread reactivity of human sera with a variant repeat of the circumsporozoite protein of Plasmodium vivax.

    ID: 1379690

    Description: epitope description:NAAGNAAGNAAGNAAG antigen name:Circumsporozoite protein host organism:Mus musculus

    Publication: 2122747;

  3. A novel recombinant multiepitope protein as a hepatitis C diagnostic intermediate of high sensitivity and specificity.

    ID: 1379700

    Description: epitope description:MSTLPKPQRQTKRNTPRRPQNVKFPGGGQIVGGVYVLPRRGPRL antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 16504539;

  4. Monoclonal antibodies to hepatitis B surface antigen (HBsAg) with anti-alpha specificity recognize a synthetic peptide analogue (S135-155) with unmodi...

    ID: 1379750

    Description: epitope description:PSCCCTKPSDGNCTCIPIPSS antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:anti-a group mAb 5D3

    Publication: 6442302;

  5. Isotype-specific immune response to a single hepatitis C virus core epitope defined by a human monoclonal antibody: diagnostic value and correlation t...

    ID: 1379756

    Description: epitope description:VYLLPR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8086507;

  6. Characterization of a natural human antibody with anti-galactosyl(alpha 1-2)galactose specificity that is present at high titers in chronic Trypanosom...

    ID: 1379789

    Description: epitope description:alpha-D-galactosyl-(1->2)-D-galactosyl group antigen name:N-glycan host organism:Homo sapiens

    Publication: 1279994;

  7. Chemically synthesized peptides elicit neutralizing antibody to bovine enterovirus.

    ID: 1379803

    Description: epitope description:TSITHWRIDF antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:mouse sera

    Publication: 1689368;

  8. Chemically synthesized peptides elicit neutralizing antibody to bovine enterovirus.

    ID: 1379806

    Description: epitope description:PSNQDSFQWQ antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:mouse sera

    Publication: 1689368;

  9. Chemically synthesized peptides elicit neutralizing antibody to bovine enterovirus.

    ID: 1379815

    Description: epitope description:VSVQDALDAQ antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:mouse sera

    Publication: 1689368;

  10. Use of synthetic peptides in the study of the antibody response to Plasmodium vivax sporozoites.

    ID: 1379852

    Description: epitope description:DGQPAGDRADGQPAGDRA antigen name:Circumsporozoite protein, putative host organism:Mus musculus antibody name:Mab 2F2

    Publication: 1689124;

  11. Immunological characteristics of a recombinant hepatitis B virus-derived multiple-epitope polypeptide: a study in polyvalent vaccine design.

    ID: 1379854

    Description: epitope description:HQLDPAFGANSTNPDWDFNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbi...

    Publication: 7513115;

  12. Immunological characteristics of a recombinant hepatitis B virus-derived multiple-epitope polypeptide: a study in polyvalent vaccine design.

    ID: 1379863

    Description: epitope description:CTTPAQGNSMFPSCCCTKPTDGNC antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White antibody name:R...

    Publication: 7513115;

  13. Use of synthetic peptides in the study of the antibody response to Plasmodium vivax sporozoites.

    ID: 1379864

    Description: epitope description:DRADGQPAGDRADGQPAGDRAAGQPAGDRAAGQPAGDRADGQPAG antigen name:Circumsporozoite protein, putative host organism:Homo sapiens

    Publication: 1689124;

  14. Immunological characteristics of a recombinant hepatitis B virus-derived multiple-epitope polypeptide: a study in polyvalent vaccine design.

    ID: 1379867

    Description: epitope description:HQLDPAFGANSTNPDWDFNP antigen name:Large envelope protein host organism:Mus musculus B10.A antibody name:Mouse sera

    Publication: 7513115;

  15. Immunological characteristics of a recombinant hepatitis B virus-derived multiple-epitope polypeptide: a study in polyvalent vaccine design.

    ID: 1379870

    Description: epitope description:HQLDPAFGANSTNPDWDFNP antigen name:Large envelope protein host organism:Mus musculus B10.A(3R) antibody name:Mouse sera

    Publication: 7513115;

  16. Immunological characteristics of a recombinant hepatitis B virus-derived multiple-epitope polypeptide: a study in polyvalent vaccine design.

    ID: 1379873

    Description: epitope description:CTTPAQGNSMFPSCCCTKPTDGNC antigen name:Large envelope protein host organism:Mus musculus B10.A antibody name:Mouse sera

    Publication: 7513115;

  17. Immunological characteristics of a recombinant hepatitis B virus-derived multiple-epitope polypeptide: a study in polyvalent vaccine design.

    ID: 1379875

    Description: epitope description:CTTPAQGNSMFPSCCCTKPTDGNC antigen name:Large envelope protein host organism:Mus musculus FVB antibody name:Mouse sera

    Publication: 7513115;

  18. Immunological characteristics of a recombinant hepatitis B virus-derived multiple-epitope polypeptide: a study in polyvalent vaccine design.

    ID: 1379877

    Description: epitope description:ALHQALQDPRVRGL antigen name:Large envelope protein host organism:Mus musculus B10.M antibody name:Mouse sera

    Publication: 7513115;

  19. Immunological characteristics of a recombinant hepatitis B virus-derived multiple-epitope polypeptide: a study in polyvalent vaccine design.

    ID: 1379879

    Description: epitope description:ALHQALQDPRVRGL antigen name:Large envelope protein host organism:Mus musculus B10.A(3R) antibody name:Mouse sera

    Publication: 7513115;

  20. Immunological characteristics of a recombinant hepatitis B virus-derived multiple-epitope polypeptide: a study in polyvalent vaccine design.

    ID: 1379881

    Description: epitope description:HQLDPAFGANSTNPDWDFNP antigen name:Large envelope protein host organism:Mus musculus B10.A antibody name:Mouse sera

    Publication: 7513115;

  21. Immunological characteristics of a recombinant hepatitis B virus-derived multiple-epitope polypeptide: a study in polyvalent vaccine design.

    ID: 1379883

    Description: epitope description:ALHQALQDPRVRGL antigen name:Large envelope protein host organism:Mus musculus B10.A antibody name:Mouse sera

    Publication: 7513115;

  22. Comparison of immune responses to a native viral antigen and a synthetic peptide derived from it: implications for vaccine development.

    ID: 1379920

    Description: epitope description:CTTPAQGNSMFPSCCCTKPTDGNC + MYRI(C1) antigen name:Large envelope protein host organism:Mus musculus antibody name:mouse sera

    Publication: 1280891;

  23. Antigenic mimicry of an immunoglobulin A epitope by a hepatitis B virus cell attachment site.

    ID: 1379954

    Description: epitope description:PAFRANTANPDWDFNPNKDTWPDANKV antigen name:Large envelope protein host organism:Oryctolagus cuniculus antibody name:Rabbit anti-21-4...

    Publication: 1699350;

  24. Antigenic mimicry of an immunoglobulin A epitope by a hepatitis B virus cell attachment site.

    ID: 1379962

    Description: epitope description:VQGFFPQQPLSVTWSESGEGVTARDFPP antigen name:Other Homo sapiens (human) protein host organism:Oryctolagus cuniculus antibody name:Rab...

    Publication: 1699350;

  25. Antigenic mimicry of an immunoglobulin A epitope by a hepatitis B virus cell attachment site.

    ID: 1379963

    Description: epitope description:VQGFFPQQPLSVTWSESGEGVTARDFPP antigen name:Other Homo sapiens (human) protein host organism:Oryctolagus cuniculus antibody name:Rab...

    Publication: 1699350;

  26. Location of monoclonal antibody binding sites in the capsid protein of feline calicivirus.

    ID: 1380009

    Description: epitope description:DTTIPGELIPAGDYAITNGTGNDITTATGYDTADIIK antigen name:Capsid protein host organism:Mus musculus antibody name:4E7, 1G9

    Publication: 1383410;

  27. Epitope mapping of the PreS1 domain of the hepatitis B virus large surface protein.

    ID: 1380116

    Description: epitope description:GGVLGWS antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:mAb 116-72

    Publication: 1693249;

  28. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380130

    Description: epitope description:ISNRDF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  29. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380135

    Description: epitope description:FVEGVS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  30. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380138

    Description: epitope description:GVSGGS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  31. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380144

    Description: epitope description:WVDIVL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  32. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380146

    Description: epitope description:DIVLEH antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  33. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380149

    Description: epitope description:LEHGSC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  34. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380153

    Description: epitope description:SCVTTM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  35. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380155

    Description: epitope description:VTTMAK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  36. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380163

    Description: epitope description:PTLDFE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  37. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380169

    Description: epitope description:IKTEAK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  38. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380170

    Description: epitope description:KTEAKQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  39. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380178

    Description: epitope description:TLRKYC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  40. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380181

    Description: epitope description:KYCIEA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  41. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380191

    Description: epitope description:TTTESR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  42. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380195

    Description: epitope description:SRCPTQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  43. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380201

    Description: epitope description:GEPSLN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  44. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380207

    Description: epitope description:EEQDKR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  45. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380214

    Description: epitope description:LCKHSM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  46. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380217

    Description: epitope description:HSMVDR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  47. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380224

    Description: epitope description:WGNGCG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  48. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380236

    Description: epitope description:IVTCAM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  49. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380237

    Description: epitope description:VTCAMF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  50. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380244

    Description: epitope description:CKKNME antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston